NHG-Standaard Versie
2.0

Aspecifieke lagerugpijn

Richtlijnen diagnostiek

Naar Volledige tekst ›

Verwijs met spoed bij vermoeden van:

  • ruptuur van een aneurysma aorta abdominalis: leeftijd > 40 jaar, acuut hevige pijn onafhankelijk van bewegen of houding, voorgeschiedenis met aneurysma aorta abdominalis, aanwijzingen voor bedreigde circulatie, afwezige of zwakke pulsaties aa. femorales.
  • cauda-equinasyndroom: (uni- of bilaterale) motorische of sensibele uitval (rijbroekanesthesie), hevige radiculaire pijn, urineretentie, incontinentie voor urine en/of feces, recente ingreep aan de rug.

Bij uitstraling in een been en voor het maken van een onderscheid tussen radiculaire en niet-radiculaire pijn, zie de NHG-Standaard Lumbosacraal radiculair syndroom.

Anamnese

Naar Volledige tekst ›
  • Duur, wijze van ontstaan (voorafgaand trauma?) en beloop van de klachten.
  • Lokalisatie, uitstraling, aard en intensiteit van de pijn.
  • Invloed van rust, beweging en houding op de klachten.
  • Mate van belemmering in het dagelijks functioneren.
  • Relatie van de klachten met de arbeidssituatie; contact met de bedrijfsarts.
  • Voorgeschiedenis: eerdere episodes met lagerugpijn, het beloop en de behandeling; maligniteit; recente ingreep aan de lumbale wervelkolom (zoals operatie of lumbaalpunctie).
  • Zelfzorg en behandeling tot nu toe.
  • Ideeën over het ontstaan en voortbestaan van de klachten.
  • Zorgen, ongerustheid, specifieke vragen en verwachtingen van de patiënt.

Vraag naar klachten die op een specifieke oorzaak kunnen wijzen bij hevige pijn, een maligniteit in de voorgeschiedenis, een recente ingreep aan de wervelkolom en/of bij een onverklaarbaar langdurig of progressief beloop (tabel 1).

Ga na of er factoren zijn die mogelijk een rol spelen bij een chronisch beloop van de klachten (herstelbelemmerende factoren) bij een klachtenduur van tenminste drie weken of bij frequent recidiveren, zoals:

  • in toenemende mate ervaren van functionele beperkingen;
  • angst voor pijn en letsel bij bewegen, vermijdingsgedrag;
  • fixatie op een mogelijk ernstige lichamelijke afwijking als verklaring van de klachten;
  • veelvuldige behandelingen zonder effect of met veel neveneffecten;
  • werkverzuim of werkloosheid, lage werktevredenheid.

Lichamelijk onderzoek

Naar Volledige tekst ›

Onderzoek de mate van bewegingsbeperking, lokaliseer de pijn en let op ernstige houdingsafwijkingen.

Aanvullend onderzoek

Naar Volledige tekst ›
  • Bij aspecifieke lagerugpijn wordt beeldvormende diagnostiek of laboratoriumonderzoek niet aanbevolen.
  • Bij vermoeden wervelfractuur: röntgendiagnostiek van thoracale en/of lumbale wervelkolom.
  • Bij vermoeden metastase van prostaatcarcinoom: zie de NHG-Standaard Mictieklachten bij mannen.

Evaluatie

Naar Volledige tekst ›
  • Stel vast of er een vermoeden is van een specifieke oorzaak van de rugpijn, zie hoofdtekst [tabel 1].
  • Stel de diagnose aspecifieke lagerugpijn bij pijn in het gebied tussen de onderste ribben en de bilplooien indien een specifieke oorzaak onwaarschijnlijk is.

Richtlijnen beleid

Naar Volledige tekst ›

Niet-medicamenteuze behandeling

Naar Volledige tekst ›
  • Het beleid is gericht op het bevorderen van bewegen en het oppakken of continueren van activiteiten. Leidraad voor de behandeling is onderstaand stappenplan.
  • Ga bij onvoldoende verbetering van het functioneren over naar de volgende stap.
  • Houd bij de keuze voor de behandeling en de snelheid van het doorlopen van het stappenplan rekening met de duur en ernst van de klachten, de reactie op eerdere behandelingen, de motivatie van de patiënt en de aanwezigheid van herstelbelemmerende factoren.
  • Bij onvoldoende resultaat: zie de NHG-Standaarden Pijn en SOLK.
Stap Toelichting
1.Voorlichting en advies
  • Aspecifieke lagerugpijn gaat meestal vanzelf binnen een aantal weken over. Adviseer in beweging te blijven en door te gaan met de dagelijkse activiteiten voor zover de klachten dit toelaten. Bewegen veroorzaakt geen schade.
  • Beeldvormende diagnostiek is niet zinvol. Er is geen relatie tussen eventueel op de foto zichtbare afwijkingen met ervaren klachten en de eventuele bevindingen hebben geen therapeutische consequenties.
  • Leg bij chronische klachten uit dat de nadruk bij de behandeling ligt op het omgaan met de klachten en het dagelijks functioneren en niet op het verdwijnen van de pijn.
2. Opbouw van activiteiten
(klachtenduur ca. 3-4 weken)
Overweeg een tijdcontingente aanpak indien de klachten binnen circa drie tot vier weken onvoldoende zijn verbeterd. Zie hoofdtekst.
3. Oefentherapie
(klachtenduur ca. 6 weken)
Een activerende en tijdcontingente aanpak door een fysio- of oefentherapeut heeft de voorkeur.
4. Gedragsmatige behandeling
(klachtenduur ca. 12 weken)
Verwijs naar een psychosomatisch fysio- of oefentherapeut voor cognitief-gedragstherapeutische behandeling gericht op verhoging van het activiteitenniveau, verandering van disfunctionele gedachten en het aanleren van copingvaardigheden.
5. Multidisciplinaire revalidatie Verwijs naar een gespecialiseerd behandel-/revalidatiecentrum bij chronische klachten, indien de patiënt nog niet is teruggekeerd in het arbeidsproces, een hoge ziektelast heeft en psychosociale factoren de klachten vermoedelijk in stand houden.

Medicamenteuze behandeling

Naar Volledige tekst ›

Schrijf alleen analgetica voor ter ondersteuning van het activerende beleid (zie de NHG-Standaard Pijn).

Controles

Naar Volledige tekst ›
  • Instrueer de patiënt terug te komen bij sterke toename van pijn of disfunctioneren, bij aanhoudende ernstige pijn (na één week), na start van een nieuwe behandeling en niet (verder) verbeteren van het disfunctioneren (na drie weken).
  • Blijf alert op aanwijzingen voor een specifieke oorzaak van de klachten (tabel 1).
  • Ga bij onvoldoende verbetering na of er herstelbelemmerende factoren zijn (zie Anamnese).

Consultatie/verwijzing

Naar Volledige tekst ›
  • Verwijs bij vermoeden van een specifieke oorzaak naar:
    • internist-oncoloog of orthopedisch chirurg (binnen één week): patiënten met een maligniteit in de voorgeschiedenis en (een niet-bekende en onbegrepen) rugpijn of bij vermoeden van een metastase zonder bekende maligniteit.
    • reumatoloog: vermoeden van axiale spondyloartritis.
    • orthopedisch chirurg: vermoeden van een andere specifieke oorzaak (bij vermoeden lumbosacraal radiculair syndroom: zie de NHG-Standaard Lumbosacraal radiculair syndroom).
  • Verwijs bij aspecifieke lagerugpijn conform het stappenplan naar fysio- of oefentherapeut, gedragsmatig therapeut of een centrum voor multidisciplinaire revalidatie.
  • Verwijs bij werkgerelateerde klachten of (dreigend) arbeidsverzuim naar de bedrijfsarts.

Belangrijkste wijzigingen

Naar Samenvatting ›
  • Voor het bepalen van het beleid is de indeling op basis van de duur van de klachten in acuut, subacuut en chronisch komen te vervallen.
  • Bij de behandeling zijn, naast de duur en de ernst van de klachten, ook de reactie op eerdere behandeling(en), de motivatie van de patiënt en de aanwezigheid van psychosociale risicofactoren die mogelijk een rol spelen bij een chronisch beloop van de klachten, van belang.
  • Leidraad voor de behandeling is een stappenplan dat bestaat uit voorlichting en advies, opbouw van activiteiten, oefentherapie, gedragsmatige behandeling en multidisciplinaire revalidatie.
  • Analgetica worden alleen geadviseerd ter ondersteuning van het activerende beleid.

Kernboodschappen

Naar Samenvatting ›
  • Houd rekening met een specifieke oorzaak van de rugpijn bij klachten die niet passen bij het normale patroon van aspecifieke lagerugpijn en bij een onverklaarbaar langdurig of progressief beloop.
  • Beeldvormende diagnostiek bij aspecifieke lagerugpijn wordt niet aanbevolen.
  • Het beleid is gericht op het bevorderen van bewegen en het oppakken of continueren van activiteiten (inclusief werk).
  • Informeer bij frequent recidiveren en/of onvoldoende verbeteren van de klachten na drie tot vier weken naar de aanwezigheid van factoren die mogelijk een rol spelen bij een chronisch beloop.

Inleiding

Naar Samenvatting ›

Scope

Naar Samenvatting ›

Diagnostiek en beleid bij aspecifieke lagerugpijn.

Buiten de scope

Naar Samenvatting ›

Behandeling van specifieke oorzaken van rugpijn, zoals:

  • maligniteit
  • wervelfractuur
  • axiale spondyloartritis
  • behandeling van pijn rond bekken en lage rug tijdens en na de zwangerschap

Overzicht

Naar Samenvatting ›
  • Aspecifieke lagerugpijn is: rugpijn in het gebied tussen de onderste ribben en de bilplooien waarbij geen specifieke lichamelijke oorzaak aanwijsbaar is.
  • Lagerugpijn kan gepaard gaan met stijfheid, spierspanning en uitstraling in de benen. 
  • Van alle gevallen van acute lagerugpijn is circa 95% aspecifiek.
  • De standaard geeft aan in welke gevallen rekening moet worden gehouden met een specifieke oorzaak van de klachten, zoals een maligniteit, wervelfractuur of axiale spondyloartritis. De behandeling van specifieke oorzaken van rugpijn valt echter buiten het bestek van deze standaard. 
  • Voor de diagnostiek bij rugpijn met uitstraling in een been, zie NHG-Standaard Lumbosacraal radiculair syndroom. 
  • Tijdens en na de zwangerschap komt pijn rond het bekken en de lage rug frequent voor, zie NHG-Standaard Zwangerschap en kraamperiode.

Deze standaard bevat landelijke samenwerkingswerkingsafspraken in samenspraak met:

  • Nederlandse Orthopaedische Vereniging (NOV)
  • Koninklijk Nederlands Genootschap voor Fysiotherapie (KNGF)
  • Vereniging van Oefentherapeuten Cesar en Mensendieck (VvOCM)

De standaard sluit aan bij Ketenzorgrichtlijn Aspecifieke Lage Rugklachten (2010) van:

  • Koninklijk Nederlands Genootschap voor Fysiotherapie (KNGF)
  • Nederlands Huisartsen Genootschap (NHG)
  • Nederlandse Orthopaedische Vereniging (NOV)
  • Nederlandse Vereniging voor Arbeids- en Bedrijfsgeneeskunde (NVAB)
  • Kwaliteitsinstituut voor de gezondheidszorg CBO

Bij de aanbevelingen is in deze standaard rekening gehouden met de diagnostische en therapeutische mogelijkheden en werkwijze in de 1e lijn

Achtergronden

Naar Samenvatting ›

Epidemiologie

Naar Samenvatting ›
  • Lagerugpijn komt frequent voor: van de westerse bevolking maakt 60 tot 90% minstens 1 keer in het leven een episode door van aspecifieke lagerugpijn.
  • De incidentie van lagerugpijn in de huisartsenpraktijk bedraagt 40,9 per 1000 patiënten per jaar (ICPC-code lage-rugpijn zonder uitstraling, 2012). 
  • De prevalentie van lagerugpijn (zonder uitstraling) in de huisartsenpraktijk bedraagt 38,5 per 1000 patiënten.
  • In een deel van de gevallen zal aspecifieke lagerugpijn onder de ICPC-code ‘lage-rugpijn met uitstraling’ en ‘rug symptomen/klachten’ worden geregistreerd. Daarom zijn de incidentie- en prevalentiecijfers van aspecifieke lagerugpijn naar alle waarschijnlijkheid hoger dan deze cijfers voor lagerugpijn zonder uitstraling. 
  • De prevalentie is in de open bevolking hoger: ongeveer de helft van de patiënten met rugpijn bezoekt met deze klachten de huisarts. 
  • De incidentie en prevalentie stijgen met de leeftijd. 
  • Vrouwen hebben vaker lagerugpijn dan mannen.
  • Aspecifieke lagerugpijn gaat gepaard met een hoge ziektelast en leidt tot hoge maatschappelijke kosten, vooral vanwege ziekteverzuim en arbeidsongeschiktheid.
Details
Epidemiologie

De incidentie van ‘lagerugpijn zonder uitstraling’ (ICPC-code L03) in de huisartsenpraktijk bedroeg in 2012 40,9 per 1000 patiënten per jaar. De incidentie stijgt met de leeftijd en is het hoogst in de leeftijdscategorie 85 jaar en ouder (58,0 per 1000 patiënten per jaar bij mannen en 67,1 per 1000 patiënten per jaar bij vrouwen). De jaarprevalentie van lagerugpijn zonder uitstraling in de huisartsenpraktijk bedraagt 38,5 per 1000 patiënten. Ook de prevalentie stijgt met de leeftijd. 1

De incidentie van ‘rug symptomen/-klachten’ (ICPC-code L02) bedroeg in 2012 30,4 per 1000 patiënten per jaar. De incidentie is het hoogst in de leeftijdscategorie 85 jaar en ouder (49,9 per 1000 patiënten per jaar bij mannen en 68,4 per 1000 patiënten per jaar bij vrouwen). De prevalentie in de huisartsenpraktijk is 28,4 per 1000 patiënten en laat dezelfde trend naar leeftijd zien als de incidentie. Een onbekend deel van de patiënten dat onder deze ICPC-code wordt geregistreerd, zal pijnklachten hoger in de rug hebben of andersoortige ruggerelateerde klachten, zoals een scoliose of wervelkanaalstenose. Ook zal een deel van de patiënten met aspecifieke lagerugpijn onder de ICPC-code ‘lagerugpijn met uitstraling’ worden gecodeerd. De incidentie van deze ICPC-code bedraagt 11,6 per 1000 patiënten per jaar en de prevalentie is 36,1 per 1000 patiënten. 1 In een Nederlands onderzoek bleek dat 50% van 103 patiënten, bij wie de huisarts de ICPC-code ‘lagerugpijn met uitstraling’ registreerde, radiculopathie had. De overige patiënten hadden lagerugpijn met niet-radiculaire uitstraling of een wervelkanaalstenose. 2

In een systematisch literatuuronderzoek naar de prevalentie van rugklachten in de open bevolking werden 165 epidemiologische onderzoeken geïncludeerd uit 54 landen. De hoogste prevalentie van lagerugpijn werd gevonden in de leeftijdscategorie 40-80 jaar. Indien rugklachten werden gedefinieerd als lagerugklachten die gepaard gaan met beperkingen in activiteiten, meer dan 1 dag aanhouden en gelokaliseerd zijn tussen de onderste rib en de bilplooien, bedroeg de gemiddelde puntprevalentie 11,9% en de eenmaandsprevalentie 23,2%. Bij vrouwen komt lagerugpijn frequenter voor dan bij mannen (gemiddelde prevalentie 35,3 respectievelijk 29,4%). 3 In een prospectief cohortonderzoek onder de Nederlandse bevolking (n = 5700) bedroeg de prevalentie circa 20%. Zeventig procent van de populatie rapporteerde echter tijdens de 10 jaar durende follow-upperiode lagerugpijn te hebben gehad. Ruim een derde had een episode met langdurige rugpijn doorgemaakt (> 1 maand of > 3 maanden (er werd een wisselende definitie op de verschillende meetpunten gehanteerd)). Zes procent rapporteerde rugpijn gedurende de gehele follow-upperiode. 4

Ruim de helft van de patiënten met rugpijn bezoekt hiervoor de huisarts. 5 In 2008 meldden zich in Nederland ongeveer 1.559.000 patiënten met rugpijn bij de huisarts. Ongeveer de helft van hen meldde zich al eerder met rugklachten. In het geval dat ze zich voor het eerst meldden, gingen de klachten bij 93% van de patiënten niet gepaard met uitstraling en bij 7% wel. Bijna 2% van de patiënten met rugpijn zonder uitstraling werd uiteindelijk verwezen naar de tweede lijn. Van de patiënten met een eerdere episode met rugpijn had 75% geen uitstraling; 7,3% van deze patiënten werd naar de tweede lijn verwezen. 6

Conclusie

Lagerugpijn komt frequent voor. De incidentie en prevalentie stijgen met de leeftijd. Vrouwen hebben vaker lagerugpijn dan mannen.

Maatschappelijke kosten

In een Nederlands onderzoek werden de kosten van rugklachten in Nederland tussen 2002 en 2007 berekend. De totale kosten van rugklachten namen af van 4,3 miljard euro in 2002 (0,9% van het BNP) tot 3,5 miljard euro in 2007 (0,6% van het BNP). In beide jaren was dit bedrag verdeeld in ongeveer 12% directe (bijv. kosten huisarts, fysiotherapeut, medicatie) en 88% indirecte kosten (verlies aan productiviteit en arbeidsverzuim). Het aantal dagen ziekteverzuim vanwege rugklachten nam af van meer dan 9 miljoen dagen per jaar in 2002 tot iets meer dan 6 miljoen dagen per jaar in 2007. De afname van de ziektekosten is waarschijnlijk grotendeels toe te schrijven aan de hervorming van de wetgeving rondom arbeidsongeschiktheid en mogelijk ook de beperking van de vergoeding van fysiotherapie vanuit de basisverzekering [Lambeek 2011]. 7 Het grootste deel van de kosten is afkomstig van de groep patiënten met chronische klachten. 8

Bij 16% van het totale aantal verzuimdagen op het werk geeft men rugklachten als oorzaak op. Van de werknemers met langdurig werkverzuim (13 weken of langer) door rugklachten meldt 63% dat de klachten verband houden met het werk. Bij 14% van de in Nederland geregistreerde arbeidsongeschikten zijn aandoeningen van de rug de oorzaak. 9

Hoy et al. schatten dat rugpijn, van de 291 onderzochte ziektebeelden, wereldwijd de meeste beperkingen teweegbrengt (op grond van de years lived with disability (YLD)). Rugpijn staat op de zesde plek wat betreft algehele ziektelast (disability adjusted life years (DALY)). 3

Conclusie

Aspecifieke lagerugpijn gaat gepaard met een hoge ziektelast en leidt tot hoge maatschappelijke kosten, vooral vanwege ziekteverzuim en arbeidsongeschiktheid.

Pathofysiologie

Naar Samenvatting ›
  • Bij acute lagerugpijn is in circa 95% van de gevallen geen specifieke lichamelijke oorzaak aanwijsbaar. 
  • Een veel gehanteerde hypothese is dat aspecifieke lagerugpijn te maken heeft met overbelasting van pijngevoelige structuren in en rond de wervelkolom, zoals tussenwervelschijven, gewrichten, zenuwen en spieren.
  • Bevindingen bij beeldvormend onderzoek, zoals standsafwijkingen of degeneratieve veranderingen, lijken, althans wat betreft de niet-ernstige vormen daarvan, geen relatie te hebben met lagerugpijn (zie ook Aanvullende diagnostiek).
  • Er is geen onderbouwing voor en consensus over een classificatie op basis van bevindingen bij lichamelijk onderzoek, zoals verschuivingen van facetgewrichten en/of wervels en pijn bij het SI-gewricht.
  • Er is onvoldoende onderbouwing voor op deze werkhypothesen gebaseerde behandelingen. 
  • Over het algemeen is het bij lagerugpijn, bij afwezigheid van risicofactoren of kenmerken die op een specifieke oorzaak wijzen (zie Evaluatie),  niet noodzakelijk om een precieze oorzaak of diagnose vast te stellen om een adequate behandeling te starten. 
Details
Classificatie van lagerugpijn

Van oudsher wordt lagerugpijn naar oorzaak onderverdeeld in aspecifiek en specifiek. Onder de specifieke oorzaken vallen onder andere het lumbosacraal radiculair syndroom, maligniteiten, infecties (zoals spondylodiscitis), wervelfracturen, axiale spondyloartritis en ernstige vormen van spondylolisthesis. In de gevallen waarbij er geen vermoeden bestaat van een specifieke oorzaak, wordt rugpijn gelabeld als aspecifiek. Dit wordt vaak gezien als een ‘verlegenheidsdiagnose’, die niet concreet richting aan het handelen geeft. Vandaar dat er veel pogingen ondernomen zijn dit profiel verder in te delen door middel van classificatiesystemen.

Van de meeste structuren in en rond de wervelkolom is weleens verondersteld dat zij de oorzaak kunnen zijn van lagerugpijn. De verschillende ideeën hebben in veel gevallen tot aparte ‘scholen’ geleid met eigen diagnostiek en behandeling. Doorgaans is men echter niet in staat op betrouwbare wijze verschillende diagnoses te onderscheiden en evenmin is aangetoond dat subcategorieën van patiënten met aspecifieke lagerugpijn een andere prognose hebben of beter op een specifieke behandeling, zoals radiofrequente behandeling, facetblokkades of injecties met corticosteroïden (intra-articulair of sacro-iliacaal), reageren. Blokkades en verschuivingen van wervels, facet- en SI-gewrichten, myofasciale pijnpunten, de categorieën van McKenzie (classificatie op basis van reactie van de pijn en beweeglijkheid op houding) en vele andere diagnoses zijn dan ook werkhypotheses bij behandelingen waarvan de effectiviteit tot op heden onvoldoende is aangetoond (zie Overige behandelingen).

Conclusie

Lagerugpijn wordt ingedeeld in aspecifiek en specifiek. Er is geen onderbouwing en consensus voor een classificatie op basis van bevindingen bij lichamelijk onderzoek.

Risicofactoren

Naar Samenvatting ›

Risicofactoren voor ontstaan

Naar Samenvatting ›

De volgende factoren spelen mogelijk een rol bij het ontstaan van aspecifieke lagerugpijn:

  • obesitas
  • werkgerelateerde psychosociale stressoren (zoals monotoon werk en veel werkstress)
  • zwaar lichamelijk werk
  • lang autorijden
  • veel tillen
  • veelvuldig de romp draaien en buigen
Details
Risicofactoren voor ontstaan

Van vele factoren is het verband onderzocht met het ontstaan van lagerugklachten. Er bestaat een aanzienlijke heterogeniteit tussen de verschillende relevante onderzoeken, onder andere op het gebied van onderzochte populatie, verschil in werkzaamheden en definities van lagerugpijn. De kwaliteit van de studies, die in de hieronder beschreven systematische literatuuronderzoeken geïncludeerd zijn, zijn van wisselende kwaliteit.

Individuele risicofactoren [K5]

Een meta-analyse van 41 cohortstudies naar risicofactoren voor het optreden van een eerste episode met rugpijn of een recidiefepisode vond dat een eerdere episode met lagerugklachten de krachtigste voorspeller is voor het ontstaan van een nieuwe episode met lagerugpijn. Daarnaast lijken het tillen van zware voorwerpen en autorijden geassocieerd met het ontstaan van lagerugpijn (oddsratio’s worden niet beschreven). Uit deze meta-analyse komt naar voren dat alcoholconsumptie, staan, lopen, zitten, sporten en totale lichamelijke activiteit waarschijnlijk geen risicofactoren zijn voor het ontstaan van lagerugpijn. 9 10

Een andere meta-analyse (13 cohort- en 27 cross-sectionele onderzoeken) toont dat de incidentie en prevalentie bij mensen die roken of bij mensen die daarmee gestopt zijn, hoger zijn dan bij mensen die nooit hebben gerookt (incidentie lagerugpijn > 1 dag de afgelopen 12 maanden: OR 1,31; 95%-BI 1,11 tot 1,55; prevalentie chronische lagerugpijn: OR 1,79; 95%-BI 1,27 tot 2,50). In het grootste deel van de geïncludeerde onderzoeken werd gecorrigeerd voor werkgerelateerde en psychosociale factoren. 11 Ditzelfde geldt voor obesitas (BMI ≥ 30 kg/m2) ten opzichte van BMI < 25 kg/m2 (9 cohort- en 24 cross-sectionele onderzoeken, n = 5094; incidentie lagerugpijn > 1 dag de afgelopen 12 maanden: OR 1,53; 95%-BI 1,22 tot 1,92). 12

De bevinding dat obesitas gepaard gaat met een verhoogde kans op het ontwikkelen van chronische rugpijn wordt bevestigd in een Noors prospectief cohortonderzoek in de open populatie, met een follow-upduur van 11 jaar (n = 18.882). Een BMI ≥ 30 kg/m2 gaf een licht verhoogd risico op het ontwikkelen van lagerugpijn ten opzichte van een BMI < 25 kg/m2 (mannen: OR 1,34; 95%-BI 1,08 tot 1,67; vrouwen: OR 1,22; 95%-BI 1,03 tot 1,46; gecorrigeerd voor mogelijk beïnvloedende factoren). Bij vrouwen gaf een BMI ≥ 30 kg/m2 ten opzichte van een BMI < 25 kg/m2 ook een verhoogd risico op een recidiefepisode met chronische rugpijn (OR 1,34; 95%-BI 1,08 tot 1,68). 13

In een systematische review van goede kwaliteit werd de relatie tussen lichamelijke activiteit en een nieuwe of eerste episode van lagerugpijn onderzocht. Uit de 25 cohort- en 5 case-controlonderzoeken werd de invloed van arbeidsgerelateerde lichamelijke activiteit op het ontstaan van lagerugpijn onderzocht en in 5 cohortonderzoeken en 1 case-controlonderzoek de invloed van niet-arbeidsgerelateerde lichamelijke activiteit. Hieruit blijkt dat alledaagse lichamelijke activiteit, zoals schoonmaken en tuinieren, geassocieerd is met een lagere kans op lagerugpijn (risicoschattingen variërend van 0,39 (95%-BI 0,20 tot 0,76) tot 0,55 (95%-BI 0,38 tot 0,80)). Intensieve lichamelijke inspanning (sporten) is matig geassocieerd met het ontstaan van lagerugpijn (risicoschattingen variërend van 1,3 (95%-BI 1,0 tot 1,6) tot 1,9 (95%-BI 1,4 tot 2,4)). 14

Psychosociale risicofactoren [K5]

In een systematisch literatuuronderzoek en meta-analyse van goede kwaliteit werden 16 onderzoeken (n = 47.447) geïncludeerd waarin de relatie tussen psychosociale werkstressoren en het ontstaan van lagerugpijn werd onderzocht. 15

Veeleisend werk (OR 1,32; 95%-BI 1,13 tot 1,53), weinig controle over het werk (OR 1,30; 95%-BI 1,11 tot 1,52), veel werkstress (OR 1,38; 95%-BI 1,07 tot 1,78), weinig sociale steun (OR 1,42; 95%-BI 1,25 tot 1,61), weinig ondersteuning door leidinggevende (OR 1,37; 95%-BI 1,19 tot 1,58), weinig veiligheid op de werkvloer (OR 1,43; 95%-BI 1,16 tot 1,76) en het verrichten van monotoon werk (OR 1,66; 95%-BI 1,34 tot 2,04) waren risicofactoren voor het ontstaan van lagerugpijn.

In andere systematische reviews worden de volgende psychosociale risicofactoren genoemd die geassocieerd worden met het ontstaan van lagerugpijn: lage sociale status, ontevredenheid met het werk, angst, depressie, emotionele instabiliteit en alcohol- of drugsmisbruik (risicofactoren niet gekwantificeerd). 10 16

Arbeidsgerelateerde risicofactoren [K5]

In de hierboven beschreven review van Heneweer et al. bleek zwaar lichamelijk werk een matige tot sterke risicofactor voor het ontstaan van lagerugpijn (risicoschattingen variërend van 1,61 (95%-BI 1,08 tot 2,39) tot 4,1 (95%-BI 2,7 tot 6,4)). De frequentie en zwaarte van tillen waren matig tot sterk geassocieerd met lagerugpijn (risicoschattingen variërend van 1,4 (95%-BI 1,0 tot 2,1) tot 3,26 (95%-BI 1,52 tot 6,98)). Ook het werken in een gebogen/geroteerde positie was geassocieerd met het ontstaan van lagerugpijn (risicoschattingen variërend van 1,5 (95%-BI 1,0 tot 2,2) tot 8,7 (95%-BI 2,1 tot 46)). Fysieke inspanning tijdens verpleging was geassocieerd met lagerugpijn (risicoschattingen variërend van 1,6 (95%-BI 1,14 tot 2,3) tot 6,2 (95%-BI 1,7 tot 23,2)). Meer dan 50 uur autorijden per week was sterk geassocieerd met het ontstaan van lagerugpijn bij vrachtwagenchauffeurs (risicoschatting 2,17 (95%-BI 1,28 tot 3,68)) en bij vrouwen (risicoschatting 2,8 (95%-BI 1,0 tot 8,5)). 14

Deze bevindingen worden bevestigd in de systematische review van Taylor et al. Hieruit blijkt dat bij bepaalde vormen en intensiteiten van fysieke belasting er een verhoogd risico bestaat op het ontstaan van aspecifieke lagerugpijn: handmatig lasten verplaatsen (vooral tillen) en veelvuldig draaien en buigen van de romp. Ook een slechte conditie en zware fysieke belasting zijn geassocieerd met het ontstaan van rugpijn. Deze bevindingen werden niet gekwantificeerd. 10

In een systematische review van Lötters et al. bleek ook algehele lichaamstrilling (in de review van Heneweer buiten beschouwing gelaten) een risicofactor voor het ontstaan van lagerugpijn (8 observationele onderzoeken, OR 1,39; 95%-BI 1.24 tot 1.55). 17

Conclusie [K4]

Obesitas, werkgerelateerde psychosociale stressoren (bijv. het verrichten van monotoon werk en veel werkstress), het verrichten van zwaar lichamelijk werk en een toenemend aantal uren autorijden, veel tillen en roteren zijn geassocieerd met het ontstaan van lagerugpijn.

Risicofactoren voor chronisch beloop

Naar Samenvatting ›

Demografische factoren hebben waarschijnlijk geen invloed op het ontstaan van chronische klachten.

Mogelijk zijn wel geassocieerd met een chronisch beloop:

  • ernstige functionele beperking
  • pijn in het been
  • radiculopathie
  • psychiatrische comorbiditeit
  • slechte algehele gezondheid

De volgende psychische en sociale factoren (in de internationale literatuur: ‘yellow flags’) spelen waarschijnlijk een rol bij het ontstaan van een chronisch beloop van aspecifieke lagerugpijn. Zo gaat lagerugpijn soms gepaard met:

  • angst voor pijn en bewegen
  • ongerustheid over het beloop
  • passieve copingstijl
  • depressieve gevoelens
  • psychische stress
Details
Risicofactoren voor chronisch beloop

De psychische en sociale factoren die mogelijk een rol spelen bij een chronisch beloop van de klachten (herstelbelemmerende factoren) worden in de internationale literatuur yellow flags genoemd. In verschillende prospectieve onderzoeken is nagegaan welke demografische, klinische, psychische en sociale factoren mogelijk een rol spelen bij het ontstaan van chronische aspecifieke lagerugpijn. Deze onderzoeken verschillen sterk wat betreft de geïncludeerde patiëntenpopulaties, de gehanteerde uitkomstmaten (o.a. door verschillen in definiëring van chroniciteit) alsmede de onderzochte prognostische factoren.

In een systematische review van goede kwaliteit werden 18 prospectieve cohortonderzoeken (n = 7331; 33% van hoge kwaliteit) geïncludeerd waarin minstens één psychosociale factor werd onderzocht bij eerstelijns patiënten met aspecifieke lagerugpijn (klachtenduur bij inclusie < 3 maanden). 18 In deze review werd onderzocht welke factoren een voorspellende waarde hebben voor de overgang van (sub)acute lagerugpijn (< 3 maanden) naar chronische lagerugpijn (> 3 maanden). Er bleken slechts weinig onafhankelijke risicofactoren te zijn. De grootste voorspellende waarde voor de ontwikkeling van chronische lagerugpijn was ‘de inschatting van de patiënt of zorgverlener dat de rugpijn aanwezig blijft’ (OR 10,40; 95%-BI 2,20 tot 49,10).

De factoren passieve copingstijl en pijngerelateerde angst, depressieve gevoelens en psychische stress bleken een voorspellende waarde te hebben, maar niet consistent in alle onderzoeken waarin deze factoren werden onderzocht. De sociale factoren werkstatus, opleidingsniveau en burgerlijke status hadden geen voorspellende waarde.

Een andere systematische review van goede kwaliteit (n = 10.842; 20 prospectieve onderzoeken, waarvan 13 in de huisartsenpraktijk, 1 in de fysiotherapiepraktijk, 2 in gespecialiseerde klinieken en 8 in het kader van een werknemersongevallenverzekering (workers compensation settings)) onderzocht risicofactoren voor het ontstaan van ernstige chronische rugklachten. De kwaliteit van de geïncludeerde onderzoeken varieerde van 2-7 op een schaal van 9 (schaal niet beschreven). Er werden associaties (grootte van de associaties zijn lastig te interpreteren en worden niet gepresenteerd vanwege het gebruik van likelihood ratio’s) gevonden tussen de volgende factoren en een slechte uitkomst na 1 jaar: slechte copingstijl, ernstige functionele beperking, pijn in het been of radiculopathie, psychiatrische comorbiditeit, slechte algehele gezondheid, hoog werkverzuim, lage werktevredenheid, pijngerelateerde angst en hoge somatisatie.

Demografische kenmerken, zoals leeftijd, geslacht, opleidingsniveau, gewicht en roken, bleken geen voorspellende waarde te hebben voor een chronisch beloop van de rugpijn. Ook een eerdere episode met lagerugpijn had geen voorspellende waarde. 19

Conclusie

Voor verschillende psychosociale factoren, zoals een passieve copingstijl, pijngerelateerde angst, depressieve gevoelens en psychische stress, worden associaties gevonden voor het ontstaan van chronische lagerugpijn.

Screening op hoog risico chronisch beloop

Naar Samenvatting ›

Een screeningsinstrument om patiënten met een hoog risico op een chronisch beloop op te sporen en de behandeling hierop te baseren, wordt niet aanbevolen.

Details
Van bewijs naar aanbeveling

De resultaten zijn in het voordeel van de interventiegroep, waarbij zowel het aantal overbehandelde patiënten (met een laag risico op een chronisch beloop, die behandeld worden met fysiotherapie) als het aantal onderbehandelde patiënten (met een hoog risico, waarbij gewacht wordt met behandeling met (psychosomatische) fysiotherapie) afneemt.

De resultaten zijn echter niet direct te extrapoleren naar de Nederlandse situatie. Hoewel het screeningsinstrument inmiddels in Denemarken is gevalideerd, zijn de betrouwbaarheid, validiteit en effectiviteit van de Nederlandse versie van het screeningsinstrument niet onderzocht. 20 21 Ditzelfde geldt voor de kosteneffectiviteit. Met name verschillen in ‘best practice’ en verschillen in het zorg- en verzekeringsstelsel maken dat de resultaten niet direct naar de Nederlandse situatie vertaald kunnen worden. Zo was ook de behandeling van de laagrisicopatiënten en de controlegroep (uitgebreide uitleg en adviezen, behandeling door fysiotherapeut) verschillend van de ‘standaardbehandeling’ in Nederland.

Een andere factor die de toepasbaarheid in de dagelijkse praktijk beperkt, is de capaciteit aan speciaal getrainde (psychosomatische) fysiotherapeuten in Nederland. Circa 28% van de patiënten heeft, volgens het STarT Back screeningsinstrument, een hoog risico op een chronisch beloop. Deze patiënten zouden door een speciaal getrainde (psychosomatische) fysiotherapeut behandeld moeten worden; het is de vraag of hier momenteel voldoende capaciteit voor is.

De werkgroep is van mening dat er op dit moment te veel kanttekeningen zijn om toepassing van het STarT Back screeningsinstrument aan te bevelen.

Samenvatting van bewijs
Achtergrond

Screeningsinstrumenten kunnen zinvol zijn om patiënten met een hoog risico op een chronisch beloop te identificeren. Voorwaarden hiervoor zijn dat het screeningsinstrument voldoende gevalideerd is om bepaalde patiëntcategorieën te identificeren, en dat deze categorieën bepalend zijn voor de behandelkeuze.

Er bestaan minstens 40 verschillende classificatiesystemen, die voornamelijk gebaseerd zijn op biomedische aspecten. Voor de meeste systemen ontbreekt het aan gegevens over betrouwbaarheid, toepasbaarheid en generaliseerbaarheid. 16 Uitzondering vormt de StarT Back Screening Tool.

De StarT Back Screening Tool omvat 9 lichamelijke en modificeerbare psychosociale factoren op grond waarvan patiënten in 3 risicogroepen worden ingedeeld: laag risico (score 0-3), middelmatig risico: (score ≥ 4 en psychosociale subscore ≤ 3) en hoog risico (score ≥ 4 en psychosociale subscore ≥ 4). Het betreft het risico op een slechte functionele uitkomst na 6 maanden (score Roland Morris Disability Questionnaire ≥ 7 (schaal 0-24)). 22 De factoren die in dit screeningsinstrument zijn opgenomen zijn onttrokken uit de literatuur en uit een secundaire analyse van 2 cohortonderzoeken.

Uitgangsvraag

Wordt toepassing van de STarT Back Screening Tool aanbevolen om bij patiënten met aspecifieke lagerugpijn het risico op een chronisch beloop in te schatten en de behandeling hierop aan te passen?

Resultaten

Beschrijving onderzoeken

Het screeningsinstrument is gevalideerd in een onafhankelijk eerstelijnscohort (n = 500). 22 In een gerandomiseerd onderzoek werd onderzocht of een, op het risico op het ontwikkelen van persisterende invaliderende lagerugpijn, gestratificeerde behandeling tot een betere uitkomst leidt (of, voor de laagrisicogroep, minstens niet slechtere uitkomst (non inferiority)). 23 Patiënten die de huisarts bezochten in verband met lagerugpijn (n = 832) werden met behulp van de STarT Back Screening Tool ingedeeld in drie risicogroepen voor het ontwikkelen van persisterende, invaliderende lagerugpijn. Zowel patiënten met kortdurende als chronische klachten werden geïncludeerd.

In de behandelgroep (n = 568) kregen patiënten in de laagrisicogroep (n = 148) alleen informatie en adviezen. Patiënten met een middelmatig risico (n = 263) werden met fysiotherapie behandeld (maximaal 6 sessies in 3 maanden, inclusief advisering, oefentherapie, manuele therapie en acupunctuur). Patiënten in de hoogrisicogroep (n = 157) kregen oefen- en manuele therapie met een gedragsmatige aanpak. Deze sessies (maximaal 6) werden door fysiotherapeuten verzorgd die getraind zijn in gesprekstechnieken gericht op behandeling van de psychologische factoren in de STarT Back Screening Tool (depressie, angst, catastroferen en vermijden).

De patiënten in de controlegroep (n = 283) werden door een fysiotherapeut beoordeeld en kregen een eerste behandeling met adviezen en oefeningen. Deze fysiotherapeut beoordeelde ook of verwijzing voor verdere fysiotherapie geïndiceerd was (‘best practice’).

Primaire uitkomstmaat was het functioneren (beoordeeld met behulp van de Roland Morris Disability Questionnaire) na 12 maanden. Na 4 en 12 maanden werden de uitkomstmaten beoordeeld aan de hand van vragenlijsten.

In het gerandomiseerde onderzoek naar het effect van een, op het risico op het ontwikkelen van persisterende invaliderende lagerugpijn, gestratificeerde behandeling had 17% van de patiënten in de behandelgroep en 19% van de patiënten in de controlegroep een klachtenduur korter dan 1 maand en 21% (behandelgroep) en 20% (controlegroep) van de patiënten had langer dan 3 jaar klachten. 23

In de controlegroep werd 49% van de patiënten in de laagrisicogroep verwezen voor fysiotherapie, 60% van de patiënten met een middelmatig risico en 65% van de patiënten met een hoog risico. Deze getallen waren in de interventiegroep resp. 7, 98 en 100%.

Kwaliteit van bewijs

De kwaliteit van bewijs is verlaagd doordat de patiënten en therapeuten niet geblindeerd waren voor de behandeling. Ook was er een aanzienlijk percentage loss to follow up na 12 maanden (23% interventiegroep en 26% controlegroep). Er is sprake van onnauwkeurigheid gezien de wijde betrouwbaarheidsintervallen. Ten slotte is er, aangezien het onderzoek in de UK werd uitgevoerd, sprake van indirect bewijs.

Effectiviteit

  • Validiteit. De discriminerende validiteit van de STarT Back Screening Tool is goed, de AUC-score (area under curve, maat voor de accuraatheid van een test: een score van 1 komt overeen met een test die perfect discrimineert, een score van 0,50 met een slechte discriminatie) voor een slechte functionaliteit na 6 maanden bedraagt 0,92 (95%-BI 0,88 tot 0,97). Het screeningsinstrument werd gevalideerd in een onafhankelijk cohort (n = 500, huisartsenpraktijken in de UK, leeftijd 18-59 jaar, aspecifieke lagerugpijn, 47% laag risico, 38% middelmatig risico, 15% hoog risico). Zes maanden later had 16,7% van de patiënten in de laagrisicogroep een slechte functionele uitkomst, 53,2% van de patiënten in de middelmatige risicogroep en 78,4% van de patiënten in de hoogrisicogroep. De AUC-scores van het screeningsinstrument waren in dit cohort vergelijkbaar met de AUC-scores in het cohort waarin het screeningsinstrument is ontwikkeld.
  • Functionaliteit. In de behandelgroep verbeterde de functionaliteit significant meer dan in de controlegroep (na 4 maanden: gemiddelde verbetering op de Roland Morris Disability Questionnaire (schaal 0-24) 4,7 (SD 5,9) versus 3,0 (SD 5,9); verschil (na correctie voor verschillende variabelen) 1,81 (95%-BI 1,0 tot 2,57). Na 12 maanden was het gemiddelde verschil voor de drie risicogroepen samen (1,06; 95%-BI 0,25 tot 1,86) niet meer significant. De patiënten met een middelmatig risico in de behandelgroep deden het echter significant beter dan de patiënten met een middelmatig risico in de controlegroep (gemiddeld verschil 1,33; 95%-BI 0,15 tot 2,52).
  • De klinische relevantie van deze bevindingen is beperkt. Over het algemeen wordt aangenomen dat een verschil > 2,5 op de Roland Morris Disability Questionnaire klinisch relevant is. Alleen in de hoogrisicogroep werd 4 maanden na inclusie een verschil > 2,5 behaald (gemiddeld verschil 2,53; 95%-BI 0,90 tot 4,16).
  • Rugpijn. De intensiteit van rugpijn na 4 maanden was in de interventiegroep significant meer afgenomen dan in de behandelgroep (gemiddelde afname 3,2 versus 2,6 (schaal 0-10); puntschatting 0,55; 95%-BI 0,23 tot 0,86); na 12 maanden was er geen significant verschil.
  • Pijngerelateerde angst. De pijngerelateerde angst (fear avoidance) nam in de behandelgroep significant meer af dan in de controlegroep (na 4 maanden: 5,5 resp. 3,2 afname (schaal 0-68); puntschatting 2,52; 95%-BI 1,61 tot 3,43; na 12 maanden: 5,2 resp. 3,3 afname; puntschatting 2,18; 95%-BI 0,73 tot 3,63).
  • Angst. Niet-specifieke angstklachten waren na 4 maanden in de behandelgroep meer afgenomen dan in de controlegroep: gemiddelde afname 1,7 respectievelijk 1,2 (schaal 0-21); puntschatting 0,63; 95%-BI 0,08 tot 1,18. Dit verschil in het voordeel van de behandelgroep was na 12 maanden niet meer significant.
  • Depressie. Ook depressieve gevoelens namen in de behandelgroep meer af dan in de controlegroep (gemiddelde afname na 4 maanden 1,7 resp. 1,1 (schaal 0-21); 0,71; 95%-BI 0,26 tot 1,15; na 12 maanden: 1,4 resp. 0,9; 0,62; 95%-BI 0,07 tot 1,17.
  • Goede uitkomst na 12 maanden. Het percentage patiënten met een goede uitkomst (gedefinieerd als minstens 30% verandering in de RMDQ-score ten opzichte van de score bij inclusie) na 12 maanden bedroeg in de laagrisicogroep in de interventiegroep 66% en in de controlegroep 60%, in de middelmatig risicogroep 67 resp. 59% en in de hoogrisicogroep 59 resp. 49%. Deze verschillen waren niet significant. Voor alle groepen samen was de kans op een goede uitkomst groter in de interventiegroep (65 vs. 57%; OR 1,48; 95%-BI 1,02 tot 2,15).
  • Patiënten in de behandelgroep meldden zich significant minder vaak ziek dan patiënten in de controlegroep (4,4 versus 12,2 dagen; puntschatting 2,76; 95%-BI 2,52 tot 3,01).
  • De uitkomsten van de patiënten met een laag risico op een chronisch beloop in de behandelgroep waren niet inferieur aan de uitkomsten in de controlegroep, hetgeen impliceert dat de eenmalige sessie voor deze patiënten niet inferieur is aan ‘best practice’.
  • Kosteneffectiviteit. De gestratificeerde behandeling was na 12 maanden kosteneffectief (verschil in kosten gezondheidszorg: £ 34,39 (€ 46,08 (koers januari 2016)); indirecte kosten (productiviteit) £ 675 (€ 904,37 (koers januari 2016)).
Conclusie

Het is onduidelijk of behandeling van patiënten met aspecifieke lagerugpijn gestratificeerd op het risico op een chronisch beloop, vastgesteld middels de STarT Back Screening Tool, tot een betere uitkomst (onder andere functionaliteit, rugpijn, werkverzuim) leidt dan de gebruikelijke zorg (‘best practice’) (kwaliteit van bewijs laag). Hoewel de gevonden verschillen klein zijn en hierdoor beperkt klinisch relevant zijn, bleek in de UK dat een op de risicoscore gestratificeerde behandeling kosteneffectief is.

Natuurlijk beloop

Naar Samenvatting ›
  • Bij aspecifieke lagerugpijn nemen de pijn en beperkingen in de meeste gevallen binnen 1 maand af. 
  • Naar schatting ontwikkelt circa 25-50% van de patiënten, in meer of mindere mate, chronische klachten (klachtenduur ≥ 12 weken). Bij deze patiënten is de kans op herstel kleiner. 
  • Meer dan 50% van de patiënten met aspecifieke lagerugpijn maakt in het jaar volgend op een eerdere episode een recidief door.
Details
Beloop
Acute lagerugpijn

In een prospectief eerstelijns cohortonderzoek (n = 605) werd gedurende twee jaar het beloop van acute lagerugpijn (klachtenduur < 1 maand) gevolgd. Bij inclusie was de gemiddelde ernst van de pijn 5,6 (schaal 0-10) en had 8% zich ziek gemeld. Na 6 maanden had 13% van de patiënten nog steeds pijnklachten (gemiddelde pijnscore 1,2). Na twee jaar was twee derde van deze patiënten hersteld. Het arbeidsverzuim na 6 maanden en 2 jaar was < 1%.

Zes maanden na inclusie had 54% van de patiënten minstens één recidief doorgemaakt. Na 2 jaar had 19% van alle patiënten (nog steeds of opnieuw) rugpijn (gemiddelde pijnscore 1,1). 24

In een systematische review (11 prospectieve eerstelijnsonderzoeken, n = 3118) werd het beloop van aspecifieke lagerugpijn (klachtenduur < 3 maanden) onderzocht. De kwaliteit van de geïncludeerde onderzoeken varieerde tussen de 40 en 90% volgens de gemodificeerde Leboeuf-criteria. Na 1 maand had 80% van de patiënten nog pijnklachten. Na 3, 6 en 12 maanden rapporteerde respectievelijk 67, 57 en 65% van de patiënten nog pijn. Het beloop van de ernst van de pijn werd niet onderzocht. 25

In verschillende andere systematische reviews wordt een gunstiger beloop gerapporteerd, met een herstel van 75 tot 90% van de patiënten binnen 4 tot 6 weken, zie de figuur. 26 16

De verschillen in de gerapporteerde percentages herstel zijn vermoedelijk het gevolg van heterogeniteit in de patiëntenpopulaties (open bevolking, huisartsenpraktijk, beroepspopulaties), inclusiecriteria (zo worden vaak niet alleen patiënten met een eerste episode geïncludeerd, maar ook patiënten met recidieven), definities van lagerugpijn, herstel en voor pijn en de toegepaste pijnscores.

In verschillende longitudinale onderzoeken is aangetoond dat ongeveer 90-95% van de mensen met lagerugpijn het werk binnen 6 tot 12 weken heeft hervat. 16

Chronische lagerugpijn

Over het algemeen wordt bij pijn die langer dan 3 maanden duurt gesproken van chronische lagerugpijn. In dit geval wordt de kans op herstel kleiner. Dit blijkt onder andere uit een in Australië uitgevoerd inceptiecohortonderzoek (een cohort van personen die in hetzelfde stadium van de onderzochte aandoening verkeren) waarin na 9 maanden 35% van de patiënten met lagerugpijn met een klachtenduur van minstens 3 maanden (n = 406) pijnvrij was en 42% na 12 maanden. Elf procent van de geïncludeerde patiënten was bij een klachtenduur van 3 maanden nog niet op het oude niveau aan het werk. Na 1 jaar was bijna de helft van deze patiënten weer op het oude niveau aan het werk. 109

Meer dan 50% van de patiënten met aspecifieke lagerugpijn heeft een recidief in het jaar volgend op de eerdere episode. Over het algemeen zijn er meer recidieven bij patiënten die in het verleden vaak of langdurig rugpijn hadden. 16

Conclusie

Bij naar schatting 50-75% van de patiënten met lagerugpijn treedt binnen 6 weken (grotendeels) herstel op. Circa 25% van de patiënten ontwikkelt chronische klachten (klachtenduur > 12 weken). Bij deze patiënten is de kans op herstel kleiner. Meer dan 50% van de patiënten met aspecifieke lagerugpijn maakt in het jaar volgend op een eerdere episode een recidief door.

Klinisch beeld

Naar Samenvatting ›
  • De pijn bij aspecifieke lagerugpijn:
    • is gelokaliseerd in het gebied tussen de onderste ribben en de bilplooien
    • is over het algemeen diffuus en zeurend van karakter 
    • gaat vaak gepaard met stijfheid, vooral na rust
  • De klachten zijn meestal houdingsgerelateerd. 
  • Soms is er pijn in 1 of beide (boven)benen. 
  • Over het algemeen staat de rugpijn meer op de voorgrond dan de eventuele uitstraling in de benen.

Richtlijnen Diagnostiek

Naar Samenvatting ›

De diagnostiek bij lagerugpijn dient om een indruk te verkrijgen van:

  • de ernst van de pijn
  • het ziektegedrag 
  • de beperkingen in fysiek functioneren en de dagelijkse werkzaamheden

Bij klachten of verschijnselen die niet passen bij het normale klachtenpatroon en/of een onverklaarbaar langdurig of progressief beloop: 

  • ga na of er symptomen zijn die wijzen op een specifieke oorzaak van de rugpijn
  • wees alert op de aanwezigheid van factoren die geassocieerd zijn met een chronisch beloop van de rugpijn

Zie NHG-Standaard Lumbosacraal radiculair syndroom voor: 

  • diagnostiek bij uitstraling in een been
  • het maken van een onderscheid tussen radiculaire en niet-radiculaire pijn 

Spoed

Naar Samenvatting ›
  • Beoordeel de klinische stabiliteit van de patiënt volgens de ABCDE-systematiek.
  • Wees alert op een ruptuur van een aneurysma aortae abdominalis bij:
    • leeftijd > 40 jaar
    • acuut hevige pijn onafhankelijk van bewegen of houding
    • een voorgeschiedenis met aneurysma aortae abdominalis
    • aanwijzingen voor een bedreigde circulatie (duizeligheid, transpireren, gevoel van flauwvallen)
  • Wees alert op een cauda-equinasyndroom bij:
    • (uni- of bilaterale) motorische en/of sensibele uitval (rijbroekanesthesie)
    • hevige radiculaire pijn
    • urineretentie en/of incontinentie voor urine en/of feces
    • recente ingreep aan de rug (< 3 dagen; bij gebruik antistolling < 14 dagen)
  • Verwijs met spoed bij:
    • vermoeden van geruptureerd aneurysma aortae abdominalis
    • vermoeden van cauda-equinasyndroom
    • na een recente ingreep aan de rug: toename van de pijn en/of uitvalsverschijnselen

Anamnese

Naar Samenvatting ›

Afhankelijk van de klachten van de patiënt en de differentieeldiagnostische overwegingen zijn de verdere anamnese en lichamelijk onderzoek meer of minder uitgebreid.

Vraag naar:

  • duur, wijze van ontstaan en beloop van de klachten
  • voorafgaand trauma
  • lokalisatie, uitstraling, aard en intensiteit van de pijn
  • invloed van rust, beweging en houding op de klachten
  • maligniteit in de voorgeschiedenis
  • mate van belemmering in het dagelijks functioneren thuis, op het werk (bijvoorbeeld verzuim of productiviteitsverlies), op school en in de vrije tijd
  • relatie van de klachten met de arbeidssituatie (invloed van klachten op het werk of andersom), contact met de bedrijfsarts
  • eerdere episodes met lagerugpijn; beloop; behandeling
  • zelfzorg en behandeling tot nu toe
  • ideeën van de patiënt over het ontstaan en voortbestaan van de klachten
  • zorgen, ongerustheid, specifieke vragen en verwachtingen van de patiënt

Uitsluiten specifieke oorzaak

Naar Samenvatting ›

Vraag naar klachten die op een specifieke oorzaak van de rugpijn kunnen wijzen bij hevige pijn, een maligniteit in de voorgeschiedenis, een recente ingreep aan de wervelkolom en/of in geval van een onverklaarbaar langdurig of progressief beloop, zoals (zie ook tabel 1):

  • algehele malaise, onverklaard gewichtsverlies, koorts, nachtzweten
  • krachtverlies, sensibiliteitsstoornissen, mictieklachten
  • uveïtis anterior, perifere artritis, enthesitis, psoriasis vulgaris, inflammatoire darmaandoening, familiair voorkomen van spondyloartritis
  • recente ingreep aan de lumbale wervelkolom (zoals operatie, lumbaalpunctie of epidurale steroïdinjectie)

Bij klachtenduur van 3 tot 4 weken of bij frequent recidiveren

Naar Samenvatting ›

Ga na of er sprake is van factoren die mogelijk een rol spelen bij een chronisch beloop van de klachten (herstelbelemmerende factoren):

  • in toenemende mate functionele beperkingen ervaren
  • andere lichamelijke klachten
  • angst voor pijn en letsel bij bewegen
  • vermijden van belasting of beweging, of ander vermijdingsgedrag
  • gevoelens van hulpeloosheid, machteloosheid (‘Ik kan niets’; ‘Ik kan er niets aan doen’)
  • fixatie op een mogelijk ernstige lichamelijke afwijking als verklaring van de klachten
  • vragen om meer en specialistisch onderzoek
  • veelvuldige behandelingen zonder effect, of met veel neveneffecten
  • ongerustheid over het beloop
  • werkverzuim of werkloosheid
  • lage werktevredenheid
  • psychische stress, angststoornis of depressie

Specifieke oorzaken

Naar Samenvatting ›

Bij een vermoeden van een specifieke oorzaak van de klachten: verricht verder lichamelijk onderzoek aan de hand van tabel 1.

Tabel 1: Specifieke oorzaken van lagerugpijn en de bijbehorende risicofactoren/kenmerken
Aandoening Risicofactoren/kenmerken
Maligniteit (wervelmetastasen of leptomeningeale metastasen)
  • Maligniteit in de voorgeschiedenis (vooral mamma-, prostaat- en longcarcinoom)
  • Leeftijd > 50 jaar
  • Continue pijn, onafhankelijk van houding of bewegen
  • Nachtelijke verergering van de pijn
  • Neurologische uitvalsverschijnselen, vaak bilateraal
  • Algehele malaise, nachtzweten
  • Onverklaard gewichtsverlies
Wervelfractuur (traumatisch of spontaan)
(zie NHG-Standaard Fractuurpreventie)
  • Leeftijd > 65 jaar
  • Vrouwelijk geslacht
  • Klachten aansluitend aan een hoogenergetisch trauma
  • Langdurig gebruik van corticosteroïden
  • Postuurverandering (versterkte thoracale kyfose)
  • Lengtevermindering
  • Plotseling ontstaan van de klachten
  • Laag lichaamsgewicht
  • Heupfracturen bij ouders

Axiale spondyloartritis (voor meer details klik onder de tabel)

  • Ontstaan van lagerugpijn voor 45e levensjaar
  • Klachtenduur > 3 maanden (bijna dagelijks)
  • Geleidelijk ontstaan van de klachten
  • Nachtelijke pijn (met verbetering na het opstaan)
  • Minder pijn en stijfheid bij bewegen
  • Geen verbetering in rust; ochtendstijfheid
  • Sterke verbetering van de pijn na gebruik van NSAID’s
  • Verstreken lumbale lordose (klachtenduur > 10 jaar), toegenomen thoracale kyfose in combinatie met verminderde beweeglijkheid wervelkolom
  • Voorgeschiedenis/positieve familieanamnese: uveïtis anterior, psoriasis vulgaris, onverklaarde perifere artritis of enthesitis, dactylitis, inflammatoire darmaandoening
Spondylolisthesis (voor meer details klik onder de tabel)
  • Begin van lagerugpijn voor 20e levensjaar
  • Palpabel trapje in verloop van processi spinosi laag lumbaal
  • Neurologische uitvalsverschijnselen
Spondylodiscitis/epiduraal abces (voor meer details klik onder de tabel)
  • Onvoldoende reactie op (hoog gedoseerde) pijnmedicatie
  • Snel progressieve neurologische uitval
  • Koorts, koude rillingen, nachtzweten
  • Onverklaard gewichtsverlies
  • Intraveneus drugsgebruik
  • Comorbiditeit: immuuncompromitterende aandoeningen)
  • Recente rugoperatie, epidurale injectie, lumbaalpunctie of zenuwwortelblokkade
Spinaal epiduraal hematoom
  • Stollingsstoornis of gebruik orale anticoagulantia
  • Snel progressieve neurologische uitvalsverschijnselen
  • Recente rugoperatie, epidurale injectie, lumbaalpunctie of zenuwwortelblokkade

 

Details
Axiale spondyloartritis
Diagnostiek axiale spondyloartritis

Axiale spondyloartritis (axSpA) is een verzamelnaam voor een groep van reumatische ziekten die wordt gekenmerkt door ontsteking van de sacro-iliacale gewrichten (SI-gewrichten) en de wervelkolom. Dit uit zich vaak in pijn en/of stijfheid van (onder)rug en/of nek. De ziekte van Bechterew (spondylitis ankylopoetica) is de meest uitgesproken en vergevorderde variant van axSpA. Uiteindelijk kan de ziekte van Bechterew resulteren in een volledige verbening van de wervelkolom.

AxSpA kan tevens gepaard gaan met ontsteking (artritis) van vooral de grote perifere gewrichten (bijvoorbeeld schouders, knieën en enkels), de gehele vinger en/of teen (dactylitis; worstvinger of -teen) en de pezen (bijv. de achillespees). Ook komen aandoeningen van de ogen (uveïtis), huid (psoriasis) en/of darmen (inflammatoire darmziekte) in verschillende mate voor.

Betrouwbare Nederlandse gegevens over de prevalentie van AxSpA ontbreken; naar schatting is bij 5-8% van de patiënten met chronische lagerugpijn (klachtenduur > 12 weken) spondylitis ankylopoetica de oorzaak van de klachten. De prevalentie bij chronische rugklachten die vóór het 45e levensjaar zijn ontstaan, is hoger.

AxSpA wordt behandeld met NSAID’s en bewegingstherapie. Bij onvoldoende effect van NSAID’s kan afhankelijk van de symptomen als volgende stap een behandeling met DMARD’s (Disease Modifying Antireumatic Drugs) of biologicals (bijv. TNF-alfablokkers) worden ingezet. 27 Een vroege diagnose is voor de behandeling van belang. 27 28

De Assessment of Spondyloarthritis International Society (ASAS) en de NVR hebben klinische en radiologische criteria opgesteld voor de diagnostiek van axSpA en inflammatoire rugpijn. Hierin worden de volgende klinische variabelen, die kunnen bijdragen aan de diagnose spondylitis ankylopoetica of andere spondylarthropathieën, genoemd. De specificiteit van de diagnose axSpA neemt toe wanneer er meer bijdragende criteria aanwezig zijn:

  • klachten ontstaan voor 45e levensjaar;
  • bijna dagelijks klachten gedurende meer dan 3 maanden;
  • inflammatoir karakter rugpijn (tenminste 4 van de 5 volgende kenmerken: ontstaan < 40e levensjaar, geleidelijk ontstaan, verbetering bij bewegen, geen verbetering bij rust, nachtelijke pijn (met verbetering na het opstaan), pijn en stijfheid nemen af na bewegen en verbeteren niet in rust);
  • wisselende bilpijn;
  • sterke verbetering van de pijn op NSAID’s (binnen 48 uur);
  • verhoogd CRP of BSE (indien bekend);
  • aanwezigheid van HLA-B27 (indien bekend);
  • sacro-iliitis op beeldvorming (indien bekend);
  • aanwezigheid van extra-axiale manifestaties (nu of in de voorgeschiedenis), zoals perifere artritis, dactylitis, achillespeesontsteking, inflammatoire darmziekte, psoriasis en uveïtis anterior;
  • positieve familieanamnese voor SpA (psoriasis, IBD, uveïtis anterior, ankyloserende spondylitis, reactieve artritis) bij eerste- of tweedegraads familieleden.

Bij vermoeden van een inflammatoire rugaandoening is een verwijzing naar een reumatoloog aangewezen. Deze zal onder andere röntgendiagnostiek verrichten naar de aanwezigheid van sacro-iliitis. Omdat radiologische sacro-iliitis (passend bij de gemodificeerde New York-criteria voor de ziekte van Bechterew) vaak pas vele jaren na aanvang van de klachten ontstaat, is dit onderzoek echter onvoldoende sensitief voor het uitsluiten van axSpA. Indien de bevindingen bij röntgenonderzoek niet aan de gemodificeerde New York-criteria voldoen, kan bij een sterke klinische verdenking op SpA door de reumatoloog vervolgonderzoek in de vorm van een MRI en/of HLA-B27-bepaling plaatsvinden.

In een eerstelijnspopulatie (n = 950) met chronische rugpijn (leeftijd < 45 jaar, klachtenduur > 2 maanden) bedroeg de sensitiviteit van HLA-B27-bepaling voor het aantonen van axiale spondyloartritis 35,4 en de specificiteit 90,9%. 29 In een andere eerstelijnspopulatie (n = 364) met chronische rugpijn (leeftijd 20-45 jaar, klachtenduur > 12 weken) had 10% van de patiënten bij wie een axiale spondyloartritis werd vastgesteld een CRP > 10 mg/l en bij 20% was HLA-B27 aanwezig. De prevalentie van HLA-B27 in de open bevolking is circa 8%. 28 Andere onderzoeken rapporteren een prevalentie van HLA-B27 bij patiënten met axiale spondyloartritis van 80-90%. Verder onderzoek naar de testeigenschappen van CRP en BSE bij vermoeden van een spondylitis ankylopoetica in een eerstelijnspopulatie werd niet gevonden. Bij een tweede- en derdelijnspopulatie met spondylitis ankylopoetica was de CRP gemiddeld 16 mg/l en de BSE 13 mm/h en correleerde de hoogte van deze waarden matig tot slecht met de ziekte-activiteit. 30

Op grond van onvoldoende sensitiviteit wordt bepaling van HLA-B27 en BSE/CRP niet aanbevolen ter uitsluiting van axiale spondyloartritis binnen de eerste lijn. 29 28

Aanbeveling

Verwijs patiënten met het anamnestische vermoeden van axiale spondyloartritis naar de reumatoloog. Röntgen- en laboratoriumdiagnostiek worden niet aanbevolen voor het aantonen of uitsluiten van axiale spondyloartritis in de eerste lijn.

Spondylolisthesis

Spondylolisthesis komt frequent voor (de prevalentie bedraagt circa 6%). In de meerderheid van de gevallen is een spondylolisthesis asymptomatisch. In naar schatting 10% van de gevallen geeft een spondylolisthesis aanleiding tot rugklachten.

Spondylolisthesis is meestal het gevolg van spondylolyse: door verbreking van de benige continuïteit in de wervelbogen kan het voorste deel van een wervel met de bovengelegen wervelkolom zich verplaatsen naar ventraal. In de meeste gevallen betreft het L5. Deze aandoeningen ontstaan doorgaans op jonge leeftijd (kind of adolescent), waarschijnlijk ten gevolge van acute of chronische traumatische invloeden (mechanische stress door bijvoorbeeld repeterende flexie-extensie-rotatiebewegingen). Zelden gaat het om een pathologische kwaliteit van bot- of bindweefsel, zoals in het kader van de ziekte van Paget of Marfan, osteogenesis imperfecta of neurofibromatosis. Een andere oorzaak van de ventrale verplaatsing van het wervellichaam zijn degeneratieve veranderingen; hierbij ontstaan eventuele symptomen meestal boven de leeftijd van 50 jaar. Ook kan een trauma of stressfractuur van de pars interarticularis leiden tot afglijding van het wervellichaam.

Een spondylolisthesis kan gepaard gaan met pijn en spanning laag lumbaal of in de lumbosacrale regio. Ook kan een spondylolisthesis aanleiding geven tot radiculaire pijnklachten. Bij een verplaatsing van de wervelkolom van meer dan 50% van het werveloppervlak (‘slip’) kan een spondylolisthesis leiden tot houdingsveranderingen: een lumbosacrale kyphose en hyperlordose lumbaal en thoracaal. Kenmerkend hierbij is dat de patiënt met gebogen knieën en heupen staat. Een palpabel trapje in het verloop van de processus spinosi kan een aanwijzing zijn voor spondylolisthesis, maar aan- of afwezigheid is niet bevestigend.

De op jonge leeftijd ontstane verplaatsing van de wervelkolom neemt bij volwassenen meestal niet of nauwelijks meer toe. Indicatie voor een operatieve ingreep (spondylodese: het operatief aan elkaar vastzetten van twee of meer wervels) is progressieve pijn, geen of onvoldoende afname van pijnklachten bij een ernstige slip (meer dan 50% van het werveloppervlak, graad 3) of progressieve neurologische uitvalsverschijnselen. Deze ernstige vorm komt slechts zelden voor. Aangezien het beleid bij spondylolyse en spondylolisthesis bij volwassenen in eerste instantie hetzelfde is als bij aspecifieke lagerugpijn, is bij aanvang van de klachten verdere diagnostiek ter opsporing van deze aandoeningen niet nodig. Pas bij hevige pijnklachten of progressieve neurologische uitvalsverschijnselen is beeldvormende diagnostiek, bij voorkeur een MRI, geïndiceerd. 31 32 33

Aanbeveling

Verwijs bij vermoeden van symptomatische spondylolisthesis (hevige pijn en/of neurologische uitvalsverschijnselen) naar de orthopedisch chirurg voor beeldvormende diagnostiek en eventuele operatieve behandeling.

Epiduraal abces

Een spinaal epiduraal abces is zeldzaam. Een epiduraal abces kan ontstaan door contaminatie bij spinale chirurgie of lumbale punctie of door uitbreiding van een lokale infectie. Meestal ontstaat een abces door hematogene verspreiding van bacteriën. Soms wordt geen focus gevonden. Een immuuncompromitterende aandoening is een risicofactor voor het ontstaan van een epiduraal abces. Een spinaal epiduraal abces presenteert zich typisch met rug-/nekpijn, koorts en neurologische uitval. Vooral in de vroegere stadia zijn de symptomen vaak minder specifiek, zoals alleen koorts of malaise. Er worden vier stadia in het ziektebeloop onderscheiden: (1) rugpijn ter hoogte van de aangedane wervel, (2) radiculaire pijn vanuit het aangedane niveau, (3) zwakte, gevoelsstoornissen en/of blaas- en darmfunctiestoornissen, (4) paralyse.

Wanneer een ruimte-innemende afwijking met myelumcompressie wordt overwogen, bijvoorbeeld bij hevige rugpijn die gepaard gaat met progressieve uitvalsverschijnselen, bestaat er altijd een spoedindicatie tot beeldvorming van het relevante segment van de wervelkolom. De behandeling bij een epiduraal abces bestaat uit de combinatie van operatief ingrijpen (decompressieve laminectomie gevolgd door drainage en spoelen van het abces) en antibiotica. Bij patiënten met een volledige paralyse gedurende meer dan 24 tot 48 uur is weinig tot geen herstel meer te verwachten. 34

Immuungecompromitteerde patiënten

Er zijn veel aandoeningen en behandelingen die het afweersysteem aantasten. Tot die aandoeningen behoren onder andere hematologische maligniteiten, systemische auto-immuunziekten (reumatoïde artritis), hiv-infectie (met name bij een CD4-getal < 0,4 × 109/l), hypogammaglobulinemie, agammaglobulinemie, status na splenectomie of beenmergtransplantatie, chronische nierziekte en gegeneraliseerde maligniteit. Voorbeelden van immunosuppressieve behandelingen zijn glucocorticosteroïden, cytostatica, DMARD’s en bestraling. De meeste immuuncompromitterende aandoeningen en geneesmiddelen ondermijnen vooral de cellulaire immuniteit. Bij de geneesmiddelen bestaat er meestal een dosis-responsrelatie: bij oplopende dosering wordt de cellulaire afweer steeds meer aangetast. 35

Lichamelijk onderzoek

Naar Samenvatting ›
  • Onderzoek hoe de patiënt beweegt, om een indruk te krijgen van:
    • de mate van bewegingsbeperking 
    • de ernst van de klachten
  • Lokaliseer de pijn
  • Let op ernstige houdingsafwijkingen
Details
Diagnostische waarde van lichamelijk onderzoek

Er bestaat geen onderzoek van aanvaardbare kwaliteit naar de diagnostische waarde van lichamelijk onderzoek, zoals beweeglijkheid, lokale drukpijn en inspectie van de wervelkolom, voor het vaststellen van een oorzaak of prognose van (aspecifieke) lagerugpijn. De inter- en intrabeoordelaarsbetrouwbaarheid van bevindingen als palpatie, lateroflexie en beoordeling van lordose is laag. 36 37 Asdrukpijn van de wervelkolom (mogelijk passend bij een maligniteit) en een trapje in het verloop van de processus spinosus (mogelijk passend bij een spondylolisthesis) vergroten de kans op een eventuele afwijking, maar geven geen absolute zekerheid over de aanwezigheid van een manifeste afwijking. Afwezigheid van deze kenmerken kan dat evenmin uitsluiten. 38

Bij anamnestische afwezigheid van aanwijzingen voor een specifieke oorzaak van de klachten is lichamelijk onderzoek in de eerste weken dan ook niet strikt noodzakelijk. Om een indruk te krijgen van de mate van bewegingsbeperking en ernst van de klachten is de werkgroep echter van mening dat het zinvol is om een lichamelijk onderzoek bij het eerste consult uit te voeren.

Uitsluiten specifieke oorzaak

Naar Samenvatting ›

Vraag naar klachten die op een specifieke oorzaak van de rugpijn kunnen wijzen bij hevige pijn, een maligniteit in de voorgeschiedenis, een recente ingreep aan de wervelkolom en/of in geval van een onverklaarbaar langdurig of progressief beloop, zoals (zie ook tabel 1):

  • algehele malaise, onverklaard gewichtsverlies, koorts, nachtzweten
  • krachtverlies, sensibiliteitsstoornissen, mictieklachten
  • uveïtis anterior, perifere artritis, enthesitis, psoriasis vulgaris, inflammatoire darmaandoening, familiair voorkomen van spondyloartritis
  • recente ingreep aan de lumbale wervelkolom (zoals operatie, lumbaalpunctie of epidurale steroïdinjectie)

Aanvullende diagnostiek

Naar Samenvatting ›

Beeldvormend onderzoek

Naar Samenvatting ›

Beeldvormende diagnostiek bij aspecifieke lagerugpijn wordt niet aanbevolen.

Details
Van bewijs naar aanbeveling

Van de degeneratieve afwijkingen die frequent, ook bij asymptomatische patiënten, bij beeldvormende diagnostiek worden aangetoond, zijn er alleen voor (ernstige) versmalling van de tussenwervelschijf aanwijzingen dat deze geassocieerd zijn met lagerugpijn. Hier zijn geen therapeutische consequenties aan verbonden. Eventuele bevindingen bij beeldvormende diagnostiek bij patiënten met aspecifieke lagerugpijn moeten in de meeste gevallen dan ook als toevalsbevinding, zonder consequenties voor het verdere beleid, worden beschouwd.

Daarnaast gaat het verrichten van röntgen- en CT-diagnostiek van de lage rug gepaard met een stralenbelasting in het gebied van de geslachtsorganen. Ten slotte heeft het verrichten van beeldvormende diagnostiek geen gunstige invloed op het beloop (geen afname in pijn of functionaliteit, zowel op de korte als lange termijn) en kunnen de eventuele bevindingen leiden tot een onjuiste ziektebeleving en pijngedrag en zelfs onnodige invasieve behandelingen.

Er bestaat consensus onder de verschillende disciplines dat er bij aspecifieke lagerugpijn geen beeldvormende diagnostiek verricht dient te worden. 9

Samenvatting van bewijs
Achtergrond

Met beeldvormende diagnostiek (röntgen-, CT- en MRI-onderzoek) kunnen in beperkte mate de aard, omvang en niveau van afwijkingen in het wervel- of wortelkanaal worden bepaald. Patiënten vragen geregeld om beeldvormende diagnostiek om uiteenlopende redenen, zoals het hebben van de behoefte aan een duidelijke en objectiveerbare oorzaak voor de pijn en ter uitsluiting van specifieke oorzaken voor de pijn, zoals een wervelmetastase.

Uitgangsvraag

Is beeldvormende diagnostiek aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Deelvragen

  • Wat is de diagnostische waarde van beeldvormende diagnostiek bij aspecifieke lagerugpijn?
  • Wat is de invloed van het verrichten van beeldvormende diagnostiek op de uitkomst bij aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Associatie tussen (degeneratieve) veranderingen bij beeldvorming en pijn/functionaliteit
  • ‘Vertraging’ in het vaststellen van een specifieke oorzaak
  • Rugpijn
  • Functionaliteit/mate van beperking
  • (Bewegings)angst
  • Arbeidsverzuim
  • Consumptie gezondheidszorg
  • Kosten gezondheidszorg

Methode

Er is een literatuurzoekactie naar systematische literatuuronderzoeken, RCT’s en observationeel onderzoek verricht in april 2015. Voor de deelvraag over de diagnostische waarde van beeldvormende diagnostiek leverde deze zoekactie 5 systematische literatuuronderzoeken op 39 40 41 42 16 en 2 prospectieve patiëntenseries. 43 44 Voor de deelvraag over de invloed van beeldvorming op de klachten leverde deze zoekactie 1 systematisch literatuuronderzoek op 45 en 3 nadien gepubliceerde onderzoeken: 1 prospectief cohortonderzoek, 40 1 RCT 46 en 1 retrospectief cohortonderzoek. 47

Resultaten

Wat is de diagnostische waarde van het verrichten van beeldvormende diagnostiek bij aspecifieke lagerugpijn?


Prevalentie afwijkingen. De prevalentie van niet-symptomatische afwijkingen bij beeldvorming van de wervelkolom is hoog. Zo is er in verschillende prospectieve patiëntenseries een prevalentie van discushernia bij 20-76% van de patiënten zonder symptomen aangetoond. Daarnaast komen andere (degeneratieve) afwijkingen, zoals discopathie, bulging van tussenwervelschijven, schmorlnoduli en facet artropathie, bij minstens 35% van de patiënten zonder lagerugklachten voor. 40 16 In een onderzoek van 98 MRI’s die verricht werden bij vrijwilligers zonder klachten (gemiddelde leeftijd 42 jaar), had slechts 36% normale disci op alle niveaus. Meer dan de helft had minstens één bulging disc en 27% een protrusie. Facet artropathie was zichtbaar bij 8% van de vrijwilligers. 44

Associatie rugpijn en afwijkingen. In een systematisch literatuuronderzoek (28 cohort-, patiëntcontrole en cross-sectionele onderzoeken, n = 26.107) werd de relatie tussen lagerugpijn en röntgenonderzoek onderzocht. Er werd een associatie gevonden tussen versmalling van de tussenwervelschijf bij röntgenonderzoek en lagerugpijn (OR 1,47; 95%-BI 1,36 tot 1,58). Andere degeneratieve veranderingen, zoals osteofyten, artrose van de facetgewrichten en dek- en sluitplaatsclerose, waren niet geassocieerd met lagerugpijn. De bewijskracht wordt verlaagd als gevolg van heterogeniteit, onder andere wat betreft gehanteerde definities voor lagerugpijn en radiologische bevindingen. 41

In een systematisch literatuuronderzoek (5 cross-sectionele onderzoeken, n = 1594) werd de associatie tussen degeneratieve veranderingen op MRI-scans en chronische lagerugpijn (klachtenduur > 3 maanden) onderzocht. Hoewel er in 4 van de 5 onderzoeken een associatie werd gevonden tussen discusdegeneratie en chronische lagerugpijn (OR’s tussen 1,8-2,8) concluderen de auteurs dat als gevolg van de lage kwaliteit van de onderzoeken en de heterogeniteit, het verband tussen degeneratieve afwijkingen en chronische lagerugpijn niet duidelijk is en dat het niet wenselijk is om routinematig MRI-onderzoek bij chronische lagerugpijn te verrichten. 39

In het systematisch literatuuronderzoek van Steffens (8 RCT’s, n = 1953) werden geen consistente associaties gevonden tussen de bevindingen op de MRI en de reactie op verschillende behandelingen. 42

In een prospectief onderzoek werden 200 personen zonder rugpijn vervolgd. Een kwart van de patiënten ontwikkelde rugpijn in de loop van vijf jaar. Bij 84% van deze patiënten veranderden de MRI-bevindingen niet of verbeterden deze zelfs. Bij 4% van de patiënten met klachten waren er nieuwe, klinisch relevante afwijkingen te zien. Deze patiënten hadden allemaal radiculaire pijnklachten. 43

Wat is de invloed van het verrichten van beeldvormende diagnostiek op de uitkomst bij aspecifieke lagerugpijn?


Chou verrichtte een systematisch literatuuronderzoek en meta-analyse (6 RCT’s, n = 1804) naar de invloed van vroege beeldvormende diagnostiek (CT-, MRI- of röntgendiagnostiek) in vergelijking tot een conservatief beleid zonder vroege beeldvorming bij patiënten met aspecifieke lagerugpijn (klachtenduur < 12 weken, eerste lijn of spoedeisende hulp). Vroege beeldvormende diagnostiek was niet geassocieerd met een betere uitkomst op de diverse uitkomstmaten, zoals pijn, functionaliteit, kwaliteit van leven en patiënttevredenheid, zowel na 3 maanden als na 6-12 maanden (kwaliteit van bewijs laag tot matig). 45

Er zijn aanwijzingen dat beeldvormende diagnostiek leidt tot meer verwijzingen, operatieve ingrepen en toegenomen gezondheidszorgkosten, zonder dat dit de uitkomst verbetert. 48 Dit blijkt onder andere uit de volgende 2 cohortonderzoeken. Jarvik verrichtte een prospectief cohortonderzoek (n = 5239) naar de invloed van beeldvormend onderzoek binnen 6 weken na het ontstaan van de klachten bij patiënten ouder dan 65 jaar. De patiënten meldden zich met nieuwe klachten van lagerugpijn, al dan niet met uitstraling, bij de huisarts of spoedeisende hulp. 1174 patiënten kregen een röntgenfoto en bij 349 patiënten werd een MRI- of CT-scan gemaakt. De onderzoekers matchten de patiënten met een vroege scan aan vergelijkbare patiënten uit dezelfde database die geen beeldvormende diagnostiek binnen 6 weken kregen. De primaire uitkomstmaat was de functionaliteit na 12 maanden (Roland Morris Disability Scale 0-24). Secundaire uitkomstmaten waren onder andere de ernst van de rugpijn en de kwaliteit van leven. Na 1 jaar waren er geen significante/klinisch relevante verschillen in de primaire en secundaire uitkomstmaten tussen de 3 groepen.

Patiënten bij wie in een vroeg stadium beeldvormend onderzoek werd verricht, maakten wel meer gebruik van de gezondheidszorg dan de controlegroep (röntgengroep 40% meer en CT-/MRI-groep 50% meer ten opzichte van de controlegroep) en maakten 27 resp. 30% meer zorgkosten dan de controlegroep. Er was geen verschil in het aantal maligniteiten dat in de 1 jaar durende follow-upperiode werd vastgesteld. In de vroege beeldvormingsgroep werden meer fracturen gevonden ten opzichte van de controlegroep (röntgen vs. controle: 2,0 vs. 0,6%; CT/MRI vs. controle: 0,9 versus 0%). 40

In een (Canadees) retrospectief cohortonderzoek (n = 647) werd onderzocht in hoeverre het verrichten van een MRI van de lumbosacrale wervelkolom, op aanvraag van de huisarts, invloed had op het verdere beleid. Bij 98,8% van de patiënten met lagerugpijn of radiculaire pijnklachten werd een afwijking gezien op de MRI. Dit waren vooral degeneratieve afwijkingen van de discus (92,2%). Discusherniatie en/of wervelkanaalstenosering werd bij ongeveer de helft van de patiënten vastgesteld. Bijna de helft van de patiënten (44,5%) werd na het verrichten van de MRI naar een orthopedisch chirurg of neurochirurg verwezen. De verwijzing kon niet duidelijk worden gerelateerd aan de bevindingen bij de MRI. Slechts 6,5% van de patiënten werd in de 3 jaar durende follow-upperiode geopereerd. Patiënten met een ernstige discushernia of wervelkanaalstenose hadden de meeste kans om geopereerd te worden. De invloed van beeldvormende diagnostiek op de uitkomstmaten pijn en functionaliteit werd in dit onderzoek niet onderzocht. 47

Ten slotte is het waarschijnlijk dat de hoge prevalentie van afwijkingen – zonder klinische consequenties – tot een toename van ziektebeleving en angst bij de patiënt leidt. Dit blijkt onder andere uit een prospectief gerandomiseerd onderzoek (n = 246), waarin het effect werd onderzocht van het al dan niet bekendmaken van de uitslag van het MRI-onderzoek bij patiënten met acute lagerugpijn of radiculaire pijnklachten die korter dan 3 weken bestonden. Na 6 weken was er geen verschil op de verschillende uitkomstmaten (pijn, angstreductie en ziekteverzuim), met uitzondering van de algehele gezondheid: deze verbeterde significant in de patiëntengroep die niet op de hoogte was van de uitslag ten opzichte van de patiëntengroep die wel op de hoogte was van de uitslag (verbetering op SF-36 (GH subscale; 0-100) na resp. 2, 4 en 6 weken: geblindeerde groep 2,5 - 4,1 - 6,0; ongeblindeerde groep: 0,4 - 1,3 - 4,2; p = 0,008). De werkgroep acht deze verschillen niet klinisch relevant. De resultaten van dit onderzoek worden vertekend door de wetenschap bij de geblindeerde patiënten dat een alarmerende bevinding zou worden gerapporteerd. 46

Conclusie

Degeneratieve afwijkingen van de disci en ossale structuren van de wervelkolom zijn waarschijnlijk niet gerelateerd aan rugklachten. Alleen versmalling van de tussenwervelschijf is mogelijk geassocieerd met rugpijn (kwaliteit van bewijs laag tot matig).

Er is waarschijnlijk geen gunstig effect van beeldvorming bij lagerugpijn op de uitkomstmaten zorgconsumptie, reductie van (bewegings-)angst en hervatting van werkzaamheden. Beeldvormende diagnostiek kan nadelig zijn omdat het de ziektebeleving (als gevolg van de hoge prevalentie van afwijkingen) en daarmee meer gezondheidszorgconsumptie in de hand kan werken (kwaliteit van bewijs laag).

Naar Samenvatting ›

Leg uit dat:

  • een duidelijk verband ontbreekt tussen (degeneratieve) afwijkingen van de wervelkolom (bijvoorbeeld van de facetgewrichten of disci) die zichtbaar zijn bij beeldvorming en aspecifieke lagerugpijn
  • er geen therapeutische consequenties worden verbonden aan deze bevindingen
  • beeldvormend onderzoek geen gunstige invloed op het beloop (geen afname in pijn of functionaliteit op de korte of lange termijn), eventuele bevindingen kunnen leiden tot een onjuiste ziektebeleving en onnodige behandelingen
  • röntgen- en CT-diagnostiek van de lage rug gaat gepaard met een stralenbelasting in het gebied van de geslachtsorganen

Vermoeden van een wervelfractuur

Naar Samenvatting ›

Vraag bij een vermoeden van een wervelfractuur röntgendiagnostiek van de thoracale en/of lumbale wervelkolom aan (zie NHG-Standaard Fractuurpreventie).

Vermoeden van een metastase van een prostaatcarcinoom

Naar Samenvatting ›

Zie voor de diagnostiek bij vermoeden van een metastase van een prostaatcarcinoom: NHG- Standaard Mictieklachten bij mannen.

Vermoeden andere specifieke oorzaken

Naar Samenvatting ›

Laboratoriumonderzoek en/of röntgendiagnostiek in de 1e lijn wordt niet aanbevolen bij een vermoeden van andere specifieke oorzaken, zoals een maligniteit of axiale spondyloartritis.

Details
Diagnostische waarde BSE en beeldvormende diagnostiek bij vermoeden van maligniteit

Een niet-verhoogde BSE (< 20 mm/h) en normale bevindingen bij röntgenonderzoek alleen sluiten met onvoldoende zekerheid een maligniteit uit bij rugklachten. Dit blijkt uit een overzicht van literatuuronderzoek bij eerstelijnspatiënten met rugpijn (zie tabel 2). 48 Op grond van deze gegevens wordt aanbevolen om patiënten met lagerugpijn en vermoeden van een maligniteit (zie Detail 7) naar de tweede lijn te verwijzen voor aanvullende diagnostiek.  

Tabel 2 (Geschatte) testeigenschappen van BSE, röntgenonderzoek en MRI-onderzoek voor het vaststellen van een maligniteit bij eerstelijnspatiënten met rugpijn 48 49
Onderzoek Sensitiviteit Specificiteit
BSE ≥ 20 mm/h 0,78 0,67
BSE ≥ 50 mm/h 0,56 0,97
Röntgenonderzoek 0,6 0,95-0,995
MRI 0,83-0,93 0,90-0,97

Specifieke oorzaak

Naar Samenvatting ›
  • Ga na of er aanwijzingen zijn voor een specifieke oorzaak (circa 5% van de gevallen)  aan de hand van tabel 1.
    • De aanwezigheid van een enkel kenmerk hoeft niet direct op een specifieke oorzaak te wijzen.
    • Een combinatie van meerdere kenmerken, zeker bij een onverklaarbaar langdurig, hevig of progressief beloop, maakt een specifieke aandoening als oorzaak waarschijnlijker.
    • Zie voor kenmerken van een lumbosacraal radiculair syndroom en cauda-equinasyndroom de NHG-Standaard Lumbosacraal radiculair syndroom.
  • Bij een vermoeden van een specifieke oorzaak van de klachten: verwijs (zie Consultatie/verwijzing)
Details
Specifieke oorzaken van lagerugpijn
Achtergrond

Bij minder dan 5% van de patiënten met lagerugpijn in de eerste lijn ligt er een specifieke aandoening, zoals een maligniteit, wervelfractuur, spondylitis ankylopoetica of spondylolisthesis, ten grondslag aan de lagerugpijn. 48 Bij de overige patiënten is er geen duidelijke oorzaak van de klachten aantoonbaar. In deze gevallen spreekt men van aspecifieke lagerugpijn.

In een eerstelijnspopulatie in Australië met acute lagerugpijn (n = 1172, klachtenduur < 6 weken) bleek gedurende de 1 jaar durende follow-upperiode 0,9% van de patiënten een ernstige oorzaak voor de klachten te hebben: 0,7% een wervelfractuur, 0,1% een cauda-equinasyndroom en 0,2% een inflammatoire aandoening. Er waren geen patiënten met een maligniteit of infectie. In dit onderzoek had circa 80% van de patiënten die zich met lagerugpijn bij de huisarts presenteerde, minstens 1 van de 25 onderzochte alarmsymptomen (het betreft alarmsymptomen zoals die gehanteerd worden in verschillende internationale richtlijnen voor lagerugpijn) [Henschke 2009]. 50

Uitgangsvraag 

Wat is de diagnostische waarde van klinische kenmerken (maligniteit in de voorgeschiedenis, hogere leeftijd, onverklaard gewichtsverlies, hevige pijn, hoog-energetisch trauma, corticosteroïdgebruik, koorts) voor het vaststellen van een specifieke oorzaak van lagerugpijn (maligniteit, wervelfractuur, infectie, spondylolisthesis, axiale spondyloartritis)?

Er is een literatuurzoekactie naar systematische literatuuronderzoeken, RCT’s en observationeel onderzoek verricht in april 2015. Per klinisch kenmerk wordt de literatuur kort samengevat. De kwaliteit van de onderzoeken is niet afzonderlijk beoordeeld en gepresenteerd, maar over het algemeen kennen deze onderzoeken beperkingen in de opzet en uitvoering, waardoor er kans op vertekening van de resultaten bestaat.

Resultaten

Maligniteit

Uit een systematisch literatuuronderzoek (SR) van Downie (14 RCT’s, 8 eerstelijns-, 2 tweedelijns- en 4 derdelijnsonderzoeken) blijkt dat het kenmerk ‘maligniteit in de voorgeschiedenis’ de grootste voorspellende waarde heeft voor de aanwezigheid van een maligniteit van de wervelkolom (wervelmetastasen of primaire maligniteit) [Downie 2013].

In de eerste lijn (prevalentie maligniteit bij patiënten met lagerugpijn 0,5%) heeft het kenmerk ‘maligniteit in de voorgeschiedenis’ bij patiënten met lagerugpijn een posttest-waarschijnlijkheid voor aanwezigheid van een spinale maligniteit van 7% (95%-BI 3 tot 16%).

De kenmerken hogere leeftijd, onverklaard gewichtsverlies en onvoldoende verbetering na een klachtenduur van 1 maand hebben ieder een posttest-waarschijnlijkheid van minder dan 3%. Het combineren van verschillende klinische kenmerken, zoals een leeftijd > 50 jaar, onverklaard gewichtsverlies, hevige pijn en een maligniteit in de voorgeschiedenis, leidt naar verwachting tot een grotere voorspellende waarde.

Wervelfractuur

In de SR van Downie (14 RCT’s, 8 eerstelijns-, 2 tweedelijns- en 4 derdelijnsonderzoeken) werd de diagnostische waarde van verschillende kenmerken voor het voorspellen van een wervelfractuur onderzocht. De klinische kenmerken hogere leeftijd (man > 65 jaar; vrouw > 75 jaar), langdurig gebruik van corticosteroïden en een hoog-energetisch trauma hebben de grootste voorspellende waarde voor de aanwezigheid van een wervelfractuur (posttest-waarschijnlijkheid resp. 9% (95%-BI 3 tot 25%), 33% (95%-BI 10 tot 67%) en 11% (95%-BI 8 tot 16%). Deze getallen zijn gebaseerd op onderzoeken uit de eerste en tweede lijn. Indien verschillende kenmerken worden gecombineerd, stijgt de voorspellende waarde. Zo bedraagt de posttest-waarschijnlijkheid op een wervelfractuur in de eerste lijn bij aanwezigheid van minstens 3 van de kenmerken ‘vrouwelijk geslacht’, ‘leeftijd > 70 jaar’, ‘hoog-energetisch trauma’ en/of ‘langdurig gebruik van corticosteroïden’ 90% (95%-BI 34 tot 99%) [Downie 2013]. De inschatting van de kans op basis van een klinische beslisregel (met deze 3 kenmerken) is echter nauwelijks beter dan de klinische inschatting door artsen [Henschke 2009].

Infecties

Bij patiënten met een spinale infectie is de sensitiviteit van koorts over het algemeen laag. In een overzichtsartikel worden de volgende testeigenschappen genoemd: de sensitiviteit varieert van 27% bij een tuberculeuze osteomyelitis tot 83% bij een epiduraal abces. De specificiteit bedraagt 98%. De sensitiviteit van percussiepijn van de wervelkolom voor een spinale infectie bedraagt 86% en de specificiteit 60% [Deyo 1992].

Er werd geen systematisch onderzoek van recentere datum gevonden naar de diagnostische waarde van klinische kenmerken voor het voorspellen van de aanwezigheid van een infectieuze oorzaak, zoals een epiduraal abces of spondylodiscitis, als oorzaak van rugpijn.

Axiale spondyloartritis

In een Nederlands prospectief onderzoek werden 364 eerstelijnspatiënten (20-45 jaar) met langer dan 12 weken rugpijn onderzocht. Bij 24% van deze patiënten stelde de reumatoloog de diagnose axiale spondyloartritis. In dit onderzoek waren een positieve uitslag op de ASAS inflammatoire rugpijn vragenlijst (OR 3,68; 95%-BI 2,16 tot 6,27), een positieve familieanamnese voor spondyloartritis (OR 2,76; 95%-BI 1,28 tot 5,97) en een goede respons op NSAID’s (OR 2,46; 95%-BI 1,44 tot 4,21) voorspellers voor de diagnose spondyloartritis [Van Hoeven 2014].

Ernstige vorm van spondylolisthesis 

Er werd geen systematisch onderzoek gevonden naar de diagnostische waarde van klinische kenmerken voor het voorspellen van de aanwezigheid van een ernstige vorm van spondylolisthesis als oorzaak van de rugpijn. Kalpakcioglu suggereert bij patiënten (n = 100) met lagerugpijn (klachtenduur > 1,5 jaar) associaties tussen de aanwezigheid van spondylolisthesis (op röntgenfoto) en de volgende klinische bevindingen: zwakke en afhangende buikwand, paravertebrale spierhypertrofie, toegenomen lumbale lordose, bij palpatie aanwijzingen voor ‘slipping’, loopafstand < 250 m en pijn tijdens extensie gecombineerd met zijwaartse flexie [Kalpakcioglu 2009].

Conclusie

Specifieke pathologie als oorzaak van lagerugpijn is zeldzaam. Er is weinig onderzoek van voldoende kwaliteit verricht naar de diagnostische waarde van klinische kenmerken voor de aanwezigheid van een specifieke oorzaak van de rugpijn. Voor zover bekend is de diagnostische waarde van individuele klinische kenmerken beperkt.

Diagnose aspecifieke lagerugpijn

Naar Samenvatting ›

Stel de diagnose aspecifieke lagerugpijn (circa 95% van de gevallen) bij rugpijn in het gebied tussen de onderste ribben en de bilplooien indien een specifieke oorzaak onwaarschijnlijk is.

Overige differentiële diagnostiek

Naar Samenvatting ›

Overweeg:

  • abdominale aandoeningen (bijvoorbeeld appendicitis, cystitis)
  • heuppathologie (bijvoorbeeld coxartrose)

Deze aandoeningen kunnen gepaard gaan en/of zich presenteren met lagerugpijn. Het beleid bij deze aandoeningen valt buiten het bestek van deze standaard.

Richtlijnen beleid

Naar Samenvatting ›

Het beleid bij aspecifieke lagerugpijn bestaat uit:

  • voorlichting
  • begeleiding 
  • maatregelen tot behoud of herstel van het dagelijks functioneren
  • aandacht voor eventuele pijnbestrijding

Stel het beleid in samenspraak met de patiënt op aan de hand van onder andere:

  • motivatie
  • comorbiditeit
  • ernst van de klachten
  • klachtenduur 
  • eventuele eerdere ervaringen

Het belangrijkste doel van dit beleid is bevorderen dat de patiënt:

  • in beweging blijft of komt, zelfs bij veel pijn en hinder
  • zo veel mogelijk normaal blijft functioneren in werk, huishouden, hobby’s en andere dagelijkse bezigheden: mede om te voorkomen dat de klachten chronisch worden

Vanwege de grote kans op spontaan herstel bestaat het beleid gedurende de 1e weken vooral uit voorlichting en adviezen om de activiteiten weer op te pakken en uit te breiden

Stappenplan

Naar Samenvatting ›

Indien de klachten binnen circa 3 weken na het begin van de klachten niet of onvoldoende verbeteren, is intensivering van de behandeling gewenst.

Een leidraad hiervoor is een stappenplan (zie Niet-medicamenteuze behandeling):

  • stap 1: voorlichting
  • stap 2: uitbreiding van activiteiten
  • stap 3: oefentherapie
  • stap 4: gedragsmatige behandeling 
  • stap 5: multidisciplinaire revalidatie

Naar Samenvatting ›

In de vorige versie van de standaard werd voor het beleid een indeling in acute, subacute en chronische aspecifieke lagerugpijn gehanteerd. Bij de herziening is deze indeling in de paragraaf Richtlijnen beleid komen te vervallen, aangezien deze indeling op basis van de klachtenduur in de praktijk moeilijk werkzaam blijkt.

In plaats hiervan is een stappenplan opgesteld waarbij niet alleen de duur van de klachten leidend is, maar ook de reactie op de (eerdere) behandeling(en), de motivatie van de patiënt en de aanwezigheid van psychosociale risicofactoren voor een chronisch beloop.

Voorlichting en advies

Naar Samenvatting ›

Geef voorlichting en adviezen over:

  • aard van de aandoening
  • mate van activiteiten
  • beeldvormende diagnostiek
  • behandeling
  • arbeidssituatie

Aard van de aandoening

Naar Samenvatting ›

Leg uit:

  • de precieze oorzaak van de lagerugpijn is onbekend. De oorzaak zit vermoedelijk in het geheel van spieren, banden en botten in de rug, dat tijdelijk niet optimaal functioneert. Dit kan niet zichtbaar worden gemaakt op een röntgenfoto.
  • pijn bij verandering van houding of bewegen is niet verontrustend en betekent niet dat er schade ontstaat.
  • rugpijn komt vaak voor en gaat meestal vanzelf binnen een aantal weken over. Meer dan de helft van de patiënten krijgt binnen een jaar opnieuw klachten. Maar ook dan gaat de rugpijn vaak vanzelf weer over.

Mate van activiteit

Naar Samenvatting ›
  • Adviseer om in beweging te blijven en door te gaan met de dagelijkse activiteiten (inclusief werk).
  • Leg uit dat bedrust niet zinvol is.
  • Adviseer bij ernstige klachten:
    • enkele dagen zo nu en dan enkele uren rust te nemen
    • daarna geleidelijk de normale activiteiten weer op te pakken, zelfs als de pijn nog steeds hevig is
Details
Van bewijs naar aanbeveling

Bedrust lijkt niet zinvol en geeft mogelijk aanleiding tot een langer ziekteverlof. Bovendien kan strikte bedrust die langer dan enkele dagen duurt tot complicaties, zoals spieratrofie, stijfheid, pneumonie, decubitus, veneuze trombo-embolie, obstipatie, urineweginfecties en afname van de botdichtheid, leiden. Op grond van deze overwegingen ontraadt de werkgroep strikte bedrust bij patiënten met aspecifieke lagerugpijn en beveelt de werkgroep een activerende benadering aan. Bij hevige klachten kan de patiënt gedurende maximaal enige dagen zo nu en dan voor enkele uren rust nemen om daarna geleidelijk de normale activiteiten weer op te pakken, zelfs als de pijn hevig is.

Samenvatting van bewijs
Achtergrond

Veel patiënten met lagerugpijn ervaren (tijdelijk) verlichting van hun klachten wanneer zij op hun rug liggen. Vooral bij ernstige houdingsgerelateerde klachten kiezen sommige patiënten met aspecifieke lagerugpijn er dan ook voor om bedrust te nemen.

Uitgangsvraag

Is bedrust aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Complicaties
  • Arbeidsverzuim

Bij de beantwoording van deze uitgangsvraag werd uitgegaan van een Cochrane-review waarin de effecten van bedrust werden onderzocht bij patiënten met acute lagerugpijn of acute radiculaire pijn. 51 Voor deze uitgangsvraag is de vergelijking tussen bedrust en het advies actief te blijven bij patiënten zonder radiculaire pijn meegenomen.

Resultaten

Beschrijving onderzoeken

In de Cochrane-review werden 3 RCT’s (n = 544) geïncludeerd die bedrust vergeleken met actief blijven bij patiënten met acute lagerugpijn met of zonder uitstralende pijn, maar zonder neurologische uitvalsverschijnselen. Eén van deze RCT’s is uitgesloten omdat er sprake was van een zeer specifieke populatie (‘combat trainees’, allen mannen tussen 17 en 34 jaar). De overige twee RCT’s includeerden volwassen mannen en vrouwen met een gemiddelde leeftijd van 40 resp. 44 jaar, via bedrijfsarts, huisarts of reumatoloog. In het ene onderzoek (n = 186) was de interventie 2 dagen bedrust, waarbij alleen incidenteel wandelen werd toegestaan en waarbij de activiteiten na 2 dagen weer werden opgebouwd. De controle was het vermijden van bedrust en het advies was om alle activiteiten zo veel mogelijk voort te zetten. In het andere onderzoek (n = 278) bestond de interventie uit 4 dagen bedrust (minimaal 16 uur per dag), behalve voor persoonlijke zorg en eten. De controle bestond uit het advies alle activiteiten zo veel mogelijk voort te zetten, en maximaal 12 uur per dag bedrust.

Kwaliteit van bewijs

De kwaliteit van het bewijs was laag tot matig. Er werd afgewaardeerd vanwege kans op vertekening en onnauwkeurigheid.

Effectiviteit

Bedrust vs. advies actief te blijven. Na 3-4 weken en na 12 weken was zowel de pijn- als de functiescore toegenomen in de bedrustgroepen vergeleken met de groepen die actief bleven (SMD’s ongeveer 0,25 voor alle uitkomsten). De verschillen waren niet klinisch relevant.

De uitkomstmaat arbeidsverzuim kon niet worden gepoold. In de ene RCT was het initiële ziekteverlof in de bedrustgroep 86% en in de actieve groep 52% (p < 0,001). In de andere RCT was het aantal dagen ziekteverlof gedurende de eerste drie weken in de bedrustgroep 3,4 dagen (95%-BI 1,6 tot 5,2) langer dan in de actieve groep; gedurende 12 weken was dit verschil opgelopen tot 4,5 dagen (95%-BI 1,4 tot 7,6).

Complicaties

Complicaties werden niet gerapporteerd.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is onduidelijk of er klinisch relevante verschillen bestaan wat betreft pijn, functionaliteit en ziekteverlof tussen bedrust en het advies actief te blijven bij patiënten met acute aspecifieke lagerugpijn (algehele kwaliteit van bewijs laag).

Beeldvormende diagnostiek

Naar Samenvatting ›

Leg uit dat:

  • lagerugpijn zonder aanwijzingen voor een specifieke oorzaak geen reden is om beeldvormende diagnostiek te verrichten. De belangrijkste argumenten hiervoor zijn (zie Aanvullende diagnostiek):
    • op de foto zichtbare afwijkingen hebben geen relatie met ervaren klachten
    • er zijn geen consequenties voor het beleid

Behandeling

Naar Samenvatting ›

Leg uit dat:

  • gezien de grote kans op spontaan herstel de behandeling bestaat uit het geven van voorlichting en adviezen gedurende de eerste weken. Bij hevige pijn kan medicamenteuze pijnbestrijding worden overwogen, hoewel de werkzaamheid hiervan waarschijnlijk beperkt is.
  • indien de klachten chronisch zijn geworden, de nadruk bij de behandeling op het omgaan met de klachten en het dagelijks functioneren komt te liggen, in plaats van op het verdwijnen van de pijn (zie Niet-medicamenteuze behandeling).

Arbeidssituatie

Naar Samenvatting ›

Als er (mogelijk) een relatie is met de arbeidssituatie, of bij werkverzuim:

Thuisarts.nl

Naar Samenvatting ›

Bied voorlichtingsmateriaal aan en verwijs naar de informatie over aspecifieke lagerugpijn op Thuisarts.nl. De informatie op Thuisarts.nl is gebaseerd op deze NHG-Standaard.

Niet-medicamenteuze behandeling

Naar Samenvatting ›

Neem bij de behandeling het volgende stappenplan als leidraad. Ga over op de volgengde stap indien een stap tot onvoldoende verbetering van het functioneren leidt.

Houd bij de keuze voor de behandeling en de snelheid van het doorlopen van het stappenplan niet alleen rekening met de duur en ernst van de klachten, maar ook met:

  • reactie op eerdere behandelingen
  • motivatie van de patiënt
  • aanwezigheid van factoren die mogelijk een rol spelen bij een chronisch beloop (zie Risicofactoren voor chronisch beloop)

Stap 1: Voorlichting en advies

Naar Samenvatting ›
  • Bespreek de punten zoals genoemd in de paragraaf Voorlichting en advies.
  • Geef extra aandacht aan patiënten die erg ongerust zijn om te bevorderen dat zij hun normale activiteiten weer oppakken. Bespreek bij het eerste contact hoe en wanneer bepaalde activiteiten kunnen worden hervat.

Stap 2: Opbouw van activiteiten

Naar Samenvatting ›
  • Overweeg het bewegen en oppakken van de activiteiten te bevorderen volgens een tijdcontingente aanpak (zie Voorbeeld tijdcontingente advisering) indien de klachten binnen circa 3 tot 4 weken na het begin van de klachten niet of onvoldoende zijn verbeterd.
  • Bespreek in geval van bewegingsangst of -armoede en als het de patiënt zelf niet lukt om de activiteiten uit te breiden, de mogelijkheid van verwijzing naar een fysio- of oefentherapeut ter begeleiding van de tijdcontingente opbouw van de activiteiten (zie Tijdcontingente aanpak).

Tijdcontingente aanpak [kader- vormgeving in ontwikkeling]

Naar Samenvatting ›
  • Stel in samenspraak met de patiënt een plan op voor een stapsgewijze, tijdcontingente uitbreiding van belasting en activiteiten, ongeacht de ervaren hinder. Zie:
  • Spreek bij alle stappen in het schema vaste termijnen af.
  • Maak de stappen naar herstel concreet met gerichte bewegingstips (zie ook Thuisarts.nl):
    • bespreek hoe de gegeven bewegingsadviezen of oefeningen kunnen aansluiten bij de ervaren belemmeringen in het dagelijks leven
Voorbeeld tijdcontingente advisering
  GEWENST: tijdcontingent ONGEWENST: pijncontingent
Bewegen Blijf bewegen en breid de activiteiten in circa veertien dagen uit naar normaal. Probeer te lopen als de pijn het toelaat.
Werk/dagelijkse activiteiten Ga na circa een week weer aan het werk. Ga aan het werk zodra de pijn het toelaat of over is.
Verwijzing Ik verwijs u naar de fysiotherapeut voor drie behandelingen. Voer in die periode onder diens begeleiding uw activiteiten geleidelijk op. Ik verwijs u voor behandeling naar een therapeut.
Controle Kom na circa drie weken terug, tenzij u dan weer normaal functioneert. Als het niet gaat, komt u terug.

Stap 3: Oefentherapie

Naar Samenvatting ›

Als de patiënt er niet in slaagt om met de tijdcontingente aanpak binnen 3 weken (totale klachtenduur circa 6 weken) de activiteiten uit te breiden tot normaal:

  • bespreek de mogelijkheid van begeleiding door een fysio- of oefentherapeut
  • adviseer volgens de voorkeuren en wensen van de patiënt:
    • er wordt geen specifieke vorm van oefentherapie aanbevolen
    • een activerende en tijdcontingente aanpak heeft de voorkeur
Details
Van bewijs naar aanbeveling

Oefentherapie 

Hoewel de effecten van oefentherapie bij aspecifieke lagerugpijn waarschijnlijk gering zijn is de werkgroep van mening dat verwijzing voor oefentherapie zinvol kan zijn bij patiënten met lagerugpijn die langer dan zes weken klachten hebben en die er niet in slagen om met een tijdcontingente aanpak binnen drie weken (totale klachtenduur circa zes weken) de activiteiten uit te breiden tot het normale niveau. Het is onwaarschijnlijk dat oefentherapie bij deze indicatie nadelige effecten heeft. Daarnaast is de werkgroep van mening dat begeleiding door een fysio- of oefentherapeut zinvol kan zijn in het signaleren en behandelen van bewegingsangst en houdingsafwijkingen. Bovendien kan de fysio- of oefentherapeut met een oefenprogramma het bewegen bevorderen. In geval van bewegingsangst of -armoede kan het zinvol zijn om de patiënt eerder te verwijzen, indien het de patiënt niet lukt om zelf de activiteiten uit te breiden.

Er zijn meerdere vormen van oefentherapie. Het is op basis van het huidige onderzoek niet mogelijk om een voorkeur uit te spreken voor een specifieke vorm van oefentherapie. Een activerende en tijdcontingente behandeling heeft de voorkeur. Het doel hiervan is de aandacht te verleggen van de pijn naar de activiteiten en de patiënt aan te leren zich in het functioneren niet door de pijn te laten leiden.

Houd rekening met de expertise en kwalificatie van de therapeut en de wensen van de patiënt. De oefentherapie kan gegeven worden door een fysio-of oefentherapeut.

Yoga en Pilates

De gepoolde resultaten wijzen op een klein voordeel voor yoga ten opzichte van educatie (wat betreft pijn en functionaliteit), maar dit effect is niet klinisch relevant. Er zijn geen voordelen van yoga boven andere vormen van (activerende) conservatieve behandeling.

De gepoolde resultaten wijzen op een klein voordeel voor pilates ten opzichte van een minimale interventie (wat betreft pijn en functionaliteit), maar dit is niet klinisch relevant. Tussen pilates en een ander oefenprogramma waren er geen verschillen, niet in effectiviteit en niet in complicaties.

Op basis van deze resultaten ziet de werkgroep geen reden om yoga of pilates aan te bevelen of te ontraden. Het is van belang dat de patiënt actief blijft; indien een patiënt er in het kader van zelfmanagement de voorkeur aan geeft om yoga of pilates te beoefenen, is er geen reden om dit te ontraden.

Samenvatting van bewijs: oefentherapie acute pijn
Achtergrond

Met oefentherapie worden behandelingsdoelen, zoals versterking van buik- en/of rugspieren, verhoging van de algehele fitheid, verbetering van stabilisatie, coördinatie en balans, nagestreefd. De term oefentherapie omvat verschillende interventies, zoals spierversterkende oefeningen, rekken en mobiliteitsoefeningen. Ook bestaan er specifieke vormen van oefentherapie, zoals Mensendieck- en Cesartherapie. Een graded activity (tijdcontingent) programma is gericht op het stapsgewijs, volgens een vast schema, opbouwen van de activiteiten met een belangrijke gedragsmatige component.

Uitgangsvraag

Is oefentherapie aan te bevelen bij patiënten met acute aspecifieke lagerugpijn (klachtenduur < 12 weken)?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Arbeidsverzuim
  • Complicaties

Het systematisch literatuuronderzoek (SR) van Hayden vormt de basis voor beantwoording van de uitgangsvraag naar de effectiviteit van oefentherapie bij patiënten met minder dan 12 weken klachten. 52 Voor graded activity werd gebruikgemaakt van de SR van Van der Giessen. 53 Een aanvullende search in maart 2015 leverde 2 RCT’s op. 54 55

Resultaten

Beschrijving onderzoeken

In de SR van Hayden werden 11 RCT’s (n = 1192) geïncludeerd waarin de effectiviteit van oefentherapie bij patiënten met minder dan 6 weken klachten werd onderzocht en 6 RCT’s (n = 881) waarin de effectiviteit van oefentherapie bij patiënten met gedurende 6-12 weken klachten werd onderzocht. De effectiviteit van oefentherapie werd vergeleken met gebruikelijke zorg, geen behandeling of andere conservatieve behandelingen.

De uitkomsten werden beoordeeld op 3 verschillende momenten: korte termijn (6 weken), middellange termijn (6 maanden) en lange termijn (> 12 maanden).

In de SR van Van der Giessen 53 werden 5 RCT’s (n = 680) geïncludeerd. Hierin werd de effectiviteit van graded activity ten opzichte van gebruikelijke zorg onderzocht bij patiënten met aspecifieke lagerugpijn met een klachtenduur van 1 tot 24 weken op de uitkomsten pijn, functionaliteit en arbeidsverzuim.

In de RCT van Nordeman (n = 60) werd de effectiviteit van oefentherapie die direct werd opgestart bij patiënten met een klachtenduur van 3-12 weken vergeleken met een wachtlijst gedurende 4 weken gevolgd door dezelfde behandeling. De uitkomstmaten waren pijn, functionaliteit en arbeidsverzuim.

In de RCT van Pengel (n = 259) werd de effectiviteit van oefentherapie en adviezen door een fysiotherapeut bij patiënten met een klachtenduur van 6-12 weken vergeleken met sham-oefeningen (oefeningen niet specifiek op de rug gericht) en sham-adviessessies (gesprek, geen adviezen specifiek op de rug gericht). De uitkomstmaten waren onder andere pijn, functionaliteit en mate van ervaren herstel.

Kwaliteit van bewijs

De kwaliteit van het bewijs was matig tot laag. De kans op vertekening was laag in 2 RCT’s. In de overige RCT’s was sprake van kans op vertekening als gevolg van een inadequate randomisatieprocedure, het ontbreken van concealment of allocation, een inadequate follow-up en/of het niet-blinderen van de beoordelaar van de uitkomsten. Verder was er sprake van indirect bewijs omdat er ook tweedelijnspopulaties werden ingesloten.

Effectiviteit

Oefentherapie vs. gebruikelijke zorg, andere conservatieve behandeling of geen behandeling (klachtenduur < 6 weken)

  • Pijn. Een meta-analyse toonde geen significante (en klinisch relevante) verschillen op de korte (10 RCT’s, n = 1097), middellange (5 RCT’s, n = 686) en lange (3 RCT’s, n = 513) termijn (kwaliteit van bewijs laag).
  • Functionaliteit. Een meta-analyse toonde geen significante (en klinisch relevante) verschillen op de uitkomstmaat functionaliteit op de korte (10 RCT’s, n = 1025), middellange (5 RCT’s, n = 684) en lange (3 RCT’s, n = 511) termijn (kwaliteit van bewijs laag).

Oefentherapie vs. gebruikelijke zorg, andere conservatieve behandeling of geen behandeling (klachtenduur 6-12 weken)

  • Pijn. Een meta-analyse toonde geen significante (en klinisch relevante) verschillen op de uitkomstmaat pijn op de korte (5 RCT’s, n = 544), middellange (4 RCT’s, n = 579) en lange (2 RCT’s, n =381) termijn (kwaliteit van bewijs laag).
  • Functionaliteit. Een meta-analyse toonde geen klinisch relevante verschillen op de uitkomstmaat functionaliteit op de korte (3 RCT’s, n = 515), middellange (4 RCT’s, n = 579) en lange (2 RCT’s, n = 381) termijn (kwaliteit van bewijs laag).
  • Arbeidsverzuim. 1 RCT met een grote kans op vertekening en 1 RCT met een lage kans op vertekening toonden minder werkverzuim bij patiënten behandeld met een graded activityprogramma op de werkplek in vergelijking met de gebruikelijke zorg (getallen niet beschreven).

Graded activity vs. gebruikelijke zorg

In het systematische literatuuronderzoek van Van der Giessen werd geen effect gevonden van graded activity ten opzichte van gebruikelijke zorg op de uitkomsten pijn, functionaliteit en arbeidsverzuim. 53

Bijwerkingen

In 26% van de in totaal 61 RCT’s (inclusief chronische lagerugpijn) werden bijwerkingen van oefentherapie gerapporteerd. Deze waren over het algemeen gering, zoals enige toename van lagerugpijn en pijnlijke spieren. De percentages werden niet beschreven.

Update van de literatuur

De 2 RCT’s naar de effectiviteit van oefentherapie laten dezelfde resultaten zien. 54 55

Conclusie

Het is onduidelijk of er klinisch relevante verschillen bestaan wat betreft pijn en functionaliteit tussen oefentherapie en gebruikelijke zorg, een andere conservatieve behandeling of geen behandeling bij acute aspecifieke lagerugpijn (algehele kwaliteit van bewijs laag).

Samenvatting van bewijs: oefentherapie chronische pijn
Achtergrond

Uitgangsvraag

Is oefentherapie aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur ≥ 12 weken)?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Arbeidsverzuim
  • Complicaties

De SR van Van Middelkoop vormt de basis voor beantwoording van deze uitgangsvraag. 56 Voor de graded activity is gebruikgemaakt van de SR van Macedo, 57 voor stabilisatieoefeningen van de SR van Smith 58 en voor het beschrijven van de effecten op arbeidsverzuim van het systematische literatuuronderzoek van Oesch. 59

Een aanvullende search in maart 2015 leverde geen RCT’s op. Tijdens de eindsearch werd in januari 2016 een SR naar graded activity gevonden. 60

Resultaten

Beschrijving onderzoeken

In de SR van Van Middelkoop werden 37 RCT’s (n = 3957) geïncludeerd waarin de effectiviteit van enige vorm van oefentherapie ten opzichte van geen behandeling of wachtlijstcontrole (8 RCT’s), gebruikelijke zorg of het advies om actief te blijven (6 RCT’s), rugschool/educatie (4 RCT’s), gedragsmatige behandeling (3 RCT’s), passieve behandelingen (bijv. Transcutane Elektrische Neuro Stimulatie (TENS) en massage) (5 RCT’s), manuele therapie (5 RCT’s) of psychotherapie (1 RCT) bij chronische aspecifieke lagerugpijn (klachtenduur > 12 weken) werd onderzocht. Ook werd onderzocht welke vorm van oefentherapie het meest effectief was (11 RCT’s). De behandelduur in de verschillende onderzoeken werd niet beschreven.

In een SR en meta-analyse van Oesch werden 23 RCT’s geïncludeerd waarin oefentherapie ten opzichte van gebruikelijke zorg bij patiënten met aspecifieke lagerugpijn (klachtenduur > 4 weken) op de uitkomstmaat arbeidsverzuim werd onderzocht op de korte (4 weken), middellange (6 maanden) en lange termijn (12 maanden).

In de SR van Macedo werden 15 RCT’s (n = 1654) geïncludeerd waarin de effectiviteit van graded activity of graded exposure werd onderzocht bij patiënten met een klachtenduur van > 6 weken op de uitkomstmaten pijn, functionaliteit, kwaliteit van leven, mate van ervaren herstel, terugkeer op de arbeidsmarkt en recidiveren. De uitkomstmaten werden onderzocht op de korte (< 3 maanden), middellange (< 12 maanden) en lange termijn (> 12 maanden). De controlebehandelingen waren een andere vorm van oefentherapie, wachtlijst, minimale interventie of geen behandeling.

In de SR en de meta-analyse van Smith werden 29 RCT’s (n = 2258) geïncludeerd waarin de effectiviteit van stabilisatie-oefeningen (‘core stability’) ten opzichte van andere behandelingen of een controlegroep bij aspecifieke lagerugpijn (onafhankelijk van klachtenduur) werd onderzocht op onder andere de uitkomstmaten pijn en mate van beperking.

Kwaliteit van bewijs

De kwaliteit van bewijs voor de uitkomstmaten pijn, mate van beperking en functionaliteit varieert van laag tot zeer laag als gevolg van kans op vertekening (15 onderzoeken (40,5%) hadden een lage kans op vertekening), inconsistentie en onnauwkeurigheid van de resultaten.

De kwaliteit van bewijs was laag voor de uitkomstmaat arbeidsverzuim (vanwege kans op vertekening en indirect bewijs: ook patiënten in de tweede lijn werden ingesloten).

Effectiviteit

Oefentherapie vs. wachtlijstcontrole/geen behandeling

  • Pijn. Direct na behandeling (5 RCT’s, n = 268) en na 6 maanden (2 RCT’s, n = 72) was er geen significant (en klinisch relevant) verschil tussen de twee behandelgroepen (kwaliteit van bewijs laag).
  • Functionaliteit. Direct na behandeling (7 RCT’s, n = 331) was er geen verschil in de mate van beperking tussen de twee behandelgroepen (kwaliteit van bewijs laag).

Oefentherapie vs. gebruikelijke zorg/advies om actief te blijven

  • Pijn. 2 RCT’s werden gepoold. Hieruit bleek een beperkt klinisch relevante afname van pijn ten gunste van de interventiegroep op de korte termijn (WMD -9,23 (schaal 0-100); 95%-BI -16,02 tot -2,43). Op de lange termijn (na 12 maanden) was er geen significant (en klinisch relevant) verschil tussen beide behandelgroepen.
  • Functionaliteit. 2 RCT’s werden gepoold. Hieruit bleek een beperkt klinisch relevante afname van de functionaliteit ten gunste van de interventiegroep op de korte termijn (3 RCT’s, n = 188; WMD -12,35 (schaal 0-100); 95%-BI -23 tot -1,69) en op de middellange termijn (2 RCT’s, n = 267; WMD -5,43; 95%-BI -9,54 tot -1,32) (kwaliteit van bewijs laag).
  • Herstel. 1 RCT (n = 222) toonde dat meer patiënten in de interventiegroep herstelden dan in de controlegroep (na 3 maanden 80% herstel vs. 47% in de controlegroep; p < 0,001) (kwaliteit van bewijs laag).
  • Arbeidsverzuim. In het systematisch literatuuronderzoek en de meta-analyse van Oesch et al. werd een verschil ten gunste van oefentherapie ten opzichte van gebruikelijke zorg gevonden op de uitkomstmaat arbeidsverzuim op de lange termijn (8 RCT’s, n = 1992; OR 0,66; 95%-BI 0,48-0,92). Er was geen verschil op de korte (5 RCT’s, n = 1030) en middellange (4 RCT’s, n = 97) termijn. Deze uitkomsten waren onafhankelijk van vorm en intensiteit van de oefeningen (kwaliteit van bewijs laag).

Oefentherapie vs. rugschool/educatie

  • Pijn. In 1 RCT (n = 60) werd geen verschil in pijn direct na de behandelperiode gevonden. In 3 RCT’s werden ook na 3 maanden (n = 200) en na 6 maanden (n = 141) geen significante (en klinisch relevante) verschillen gevonden (kwaliteit van bewijs zeer laag).
  • Functionaliteit. In 2 RCT’s (n = 139) bleek oefentherapie een beperkt klinische relevante afname van de mate van beperking aan het einde van de behandelperiode te bewerkstelligen ten opzichte van rugschool/educatie (WMD -11,20 (schaal 0-100); 95%-BI -16,78 tot -5,62). Na 6 maanden (3 RCT’s, n = 141) was er geen significant (en klinisch relevant) verschil (kwaliteit van bewijs zeer laag).

Oefentherapie vs. gedragsmatige behandeling

  • Pijn. Er werden geen significante (en klinisch relevante) verschillen gezien op de korte (2 RCT’s, n = 146), en middellange (3 RCT’s, n = 258) termijn (kwaliteit van bewijs laag).
  • Functionaliteit. Er werden geen significante (en klinisch relevante) verschillen gezien op de korte (2 RCT’s, n = 146), middellange (3 RCT’s, n = 258) en lange (3 RCT’s, n = 243) termijn (kwaliteit van bewijs laag).

Oefentherapie vs. TENS/laserbehandeling/echo/massage

  • Pijn. Er werd geen significant (en klinisch relevant) verschil gezien direct na behandeling (5 RCT’s, n = 286) en na 3 maanden (2 RCT’s, n = 162) (kwaliteit van bewijs laag).
  • Functionaliteit. Er werd geen significant (en klinisch relevant) verschil gezien direct na behandeling (5 RCT’s, n = 286) en na 3 maanden (2 RCT’s, n = 162) (kwaliteit van bewijs laag).

Oefentherapie vs. manuele therapie

  • Pijn. Direct na de behandeling (3 RCT’s, n = 395) was er een significant, maar niet klinisch relevant effect ten gunste van oefentherapie (WMD 5,67 (schaal 0-100); 95%-BI 1,99-9,35). Er was geen significant (en klinisch relevant) verschil tussen oefentherapie en manuele therapie direct na de behandeling (3 RCT’s, n = 395), op de korte (2 RCT’s, n = 326), middellange (6 RCT’s, n = 461) en lange (4 RCT’s, n = 515) termijn (kwaliteit van bewijs laag).
  • Functionaliteit. Er was geen significant (en klinisch relevant) verschil tussen oefentherapie en manuele therapie op de uitkomstmaten direct na behandeling (3 RCT’s, n = 398), op de korte (2 RCT’s, n = 326), middellange (3 RCT’s, n = 461) en lange termijn (5 RCT’s, n = 553) (kwaliteit van bewijs is laag).

Oefentherapie vs. psychotherapie

  • Pijn. In 1 RCT (n = 33) met grote kans op vertekening was er geen verschil direct na behandeling en na 6 maanden.
  • Functionaliteit. In 1 RCT (n = 33) met grote kans op vertekening was er direct na behandeling een significant effect ten gunste van oefentherapie (p = 0,02). De klinische relevantie was niet te beoordelen, aangezien er geen getallen werden genoemd. Er was geen verschil na 6 maanden.

Verschillende vormen van oefentherapie ten opzichte van elkaar

Als gevolg van heterogeniteit tussen de behandelingen konden de resultaten van 11 RCT’s niet worden gepoold. In 8 RCT’s werden er geen significante verschillen gevonden tussen de verschillende vormen van oefentherapie.

Graded activity

In de SR van Macedo werden geen klinisch relevante verschillen gevonden van graded activity of graded exposure ten opzichte van elkaar of ten opzichte van een andere behandeling of geen behandeling.

De in de eindsearch gevonden SR van Lopez-de-Uralde-Villanueva ondersteunt deze resultaten. Er werd alleen een positief effect gevonden op de functionaliteit van graded activity ten opzichte van een controlegroep (wachtlijstcontrole of gebruikelijke zorg) op de lange termijn (3 RCT’s, n = 254; SMD -0,53; 95%-BI -0,79 tot -0,27). Op de korte en middellange termijn werden geen klinisch relevante effecten gevonden. Ook voor de uitkomstmaat pijn, of indien werd vergeleken met een andere vorm van oefentherapie, werd er geen significant of klinisch relevant gevonden (kwaliteit van bewijs laag).

Stabilisatieoefeningen

In de SR van Smith werden geen klinisch relevante verschillen gevonden van stabilisatieoefeningen (‘core stability’) ten opzichte van andere behandelingen of een controlegroep bij aspecifieke lagerugpijn (onafhankelijk van klachtenduur) (pijn: -6,39 (schaal 0-100); 95%-BI -10,14 tot -2,65; mate van beperking: -3,92 (schaal 0-100); 95%-BI -7,25 tot -0,59). Ook was er geen significant of klinisch relevant verschil bij vergelijking met andere vormen van oefentherapie.

Bijwerkingen

In geen van de geïncludeerde onderzoeken werden bijwerkingen beschreven.

Conclusie

Het effect van oefentherapie versus gebruikelijke zorg of het advies om actief te blijven bij chronische aspecifieke lagerugpijn op de uitkomstmaten functionaliteit, herstel en arbeidsverzuim is onduidelijk en van beperkte klinische relevantie (kwaliteit van bewijs laag).

Het effect van oefentherapie ten opzichte van rugschool of educatie op de functionaliteit is zeer onduidelijk (kwaliteit van bewijs zeer laag).

Het is onduidelijk of er klinisch relevante verschillen bestaan wat betreft pijn en functionaliteit tussen oefentherapie vergeleken met wachtlijstcontrole/geen behandeling, manuele therapie, passieve behandelingen, gedragsmatige behandeling en psychotherapie. Ook is er onduidelijkheid over het bestaan van klinisch relevante verschillen tussen de verschillende vormen van oefentherapie (kwaliteit van bewijs laag).

Samenvatting van bewijs: yoga
Achtergrond

Yoga is de laatste jaren een populaire vorm van oefenen geworden. De nadruk ligt op versterking van de spieren die ervoor zorgen dat het lichaam in de correcte balans staat en die de wervelkolom ondersteunen. Het is onbekend wat het effect is van yoga op het verminderen van pijn en beperkingen bij patiënten met aspecifieke lagerugpijn.

Uitgangsvragen

A Is yoga aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Complicaties

Bij de beantwoording van deze uitgangsvraag werd uitgegaan van een systematisch literatuuronderzoek (SR) van Cramer uit 2013 naar de effectiviteit van yoga bij lagerugpijn. 61

Resultaten

Beschrijving onderzoeken

In de SR werden 10 RCT’s (n = 967) geïncludeerd waarin de effectiviteit van yoga bij lagerugpijn werd onderzocht. Inclusiecriteria waren RCT’s die patiënten met aspecifieke lagerugpijn includeerden, onafhankelijk van oorzaak, duur of uitstraling, en yoga vergeleken met geen behandeling, standaardzorg of een actieve behandeling. Acht onderzoeken includeerden alleen patiënten met aspecifieke lagerugpijn, 9 onderzoeken includeerden alleen patiënten met chronische lagerugpijn (klachtenduur meer dan 12 weken). 2 RCT’s vergeleken yoga met standaardzorg, 7 RCT’s vergeleken yoga met een vorm van educatie en 3 RCT’s vergeleken yoga met een ander oefenprogramma. Er is geen onderscheid gemaakt tussen verschillende vormen van yoga.

Kwaliteit van bewijs

De kwaliteit van het bewijs varieerde van zeer laag tot matig. Er werd in alle gevallen afgewaardeerd vanwege onnauwkeurigheid van de resultaten. Daarnaast werd voor enkele uitkomstmaten afgewaardeerd vanwege kans op vertekening, inconsistentie of indirect bewijs.

Effectiviteit

  • Yoga vs. standaardzorg. De enige uitkomstmaat die gepoold kon worden, was functionaliteit op de korte termijn (6 tot 24 weken, 2 RCT’s, n = 106). Hierin was geen verschil tussen yoga en standaardzorg (SMD -0,65; 95%-BI -1,62 tot 0,33).
  • Yoga vs. educatie. Op de korte termijn (12 tot 16 weken) leidde yoga tot verbetering van pijn en functionaliteit ten opzichte van educatie, maar de verschillen waren niet klinisch relevant (5 RCT’s, n = 494; pijn: SMD -0,45; 95%-BI -0,63 tot -0,26; functie: SMD -0,28; 95%-BI -0,65 tot -0,25). Op de lange termijn (26 tot 52 weken) was het verschil in pijn niet meer aan te tonen (SMD -0,28; 95%-BI -0,58 tot 0,02); het verschil in functionaliteit bleef bestaan, maar was niet klinisch relevant (SMD -0,39; 95%-BI -0,66 tot -0,11).
  • Yoga vs. ander oefenprogramma. De enige uitkomstmaat die gepoold kon worden, was functionaliteit op de korte termijn (1 tot 12 weken, 2 RCT’s, n = 263). Hierin was geen verschil tussen yoga en standaardzorg (SMD -0,59; 95%-BI -1,85 tot 0,67).

Complicaties

Drie RCT’s rapporteerden het optreden van bijwerkingen. In één RCT traden geen ernstige bijwerkingen op. In een andere RCT traden lichte tot matig ernstige bijwerkingen op bij 13 personen (niet nader toegelicht); 1 persoon in de yogagroep kreeg een discushernia (niet nader toegelicht). In de derde RCT traden bij 11 personen lichte bijwerkingen op, voornamelijk pijn; bij 1 persoon in de yogagroep was de pijn zo hevig dat deze als ernstige bijwerking werd beschouwd.

Conclusie

Het is zeer onduidelijk of er klinisch relevante verschillen bestaan in functionaliteit tussen yoga en standaardzorg of tussen yoga en een ander oefenprogramma bij patiënten met chronische aspecifieke lagerugpijn (algehele kwaliteit van bewijs zeer laag). Het is aannemelijk dat er geen klinisch relevante verschillen bestaan in pijn en functionaliteit tussen yoga en educatie bij patiënten met chronische aspecifieke lagerugpijn (algehele kwaliteit van bewijs matig).

Samenvatting van bewijs: Pilates
Achtergrond

Pilates is de laatste jaren een populaire vorm van oefenen geworden. De nadruk ligt op versterking van de spieren die ervoor zorgen dat het lichaam in de correcte balans staat en die de wervelkolom ondersteunen. Het is onbekend wat het effect is van pilates op het verminderen van pijn en beperkingen bij patiënten met aspecifieke lagerugpijn.

Uitgangsvragen

Is pilates aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Complicaties

Bij de beantwoording van deze uitgangsvraag werd uitgegaan van een  Cochrane-review naar de effectiviteit van pilates bij lagerugpijn. 62

Resultaten

Beschrijving onderzoeken

In de SR werden 10 RCT’s (n = 535) geïncludeerd waarin de effectiviteit van pilates werd onderzocht. Inclusiecriteria waren RCT’s die patiënten met aspecifieke lagerugpijn includeerden, onafhankelijk van de duur hiervan. Eén RCT includeerde patiënten met een klachtenduur van minimaal 6 weken, de overige RCT’s met een minimale klachtenduur van 12 weken tot 6 maanden. 6 RCT’s (n = 280) vergeleken pilates met een minimale interventie: in vrijwel alle gevallen voortzetting van de gebruikelijke zorg, in één RCT werd een educatieve folder uitgereikt. De overige 4 RCT’s (n = 255) vergeleken pilates met een ander oefenprogramma.

Kwaliteit van bewijs

De kwaliteit van het bewijs was laag tot matig. Er werd in alle gevallen afgewaardeerd vanwege onnauwkeurigheid. Daarnaast werd voor veel uitkomstmaten afgewaardeerd vanwege kans op vertekening of inconsistentie.

Effectiviteit

  • Pilates vs. minimale interventie. Zowel op de korte termijn (tot 3 maanden) als op de middellange termijn (3 tot 12 maanden) was er een significante verbetering van pijn en functionaliteit in de groepen die pilates kregen ten opzichte van de groepen die een minimale (controle-)interventie kregen. De gemiddelde verschillen liepen uiteen van 8 tot 14 punten op een schaal van 100, en de bijbehorende 95%-BI’s van 3 tot 20. De verschillen waren zo klein dat ze niet of beperkt klinisch relevant waren.
  • Pilates vs. ander oefenprogramma. De resultaten van pijn konden niet gepoold worden omdat er te veel heterogeniteit tussen de onderzoeken was. Geen enkel onderzoek gaf echter een klinisch relevante verbetering van pijn aan, zowel op de korte als op de middellange termijn. Er was geen verschil in functionaliteit tussen pilates en andere oefeningen.

Complicaties

Twee RCT’s onderzochten het optreden van bijwerkingen. In de ene RCT traden geen bijwerkingen op. In de andere RCT traden lichte bijwerkingen op in zowel de pilatesgroep (eenmaal knie- en tweemaal schouderpijn; in alle gevallen kon het programma worden voortgezet) als de groep die algemene oefeningen kreeg (tweemaal rugspasmen, waarna het oefenprogramma kon worden voortgezet; tweemaal verergering van de rugpijn, waardoor het oefenprogramma moest worden gestopt).

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is onduidelijk of er klinisch relevante verschillen bestaan wat betreft pijn en functionaliteit tussen pilates en een minimale (controle-)interventie of tussen pilates en een ander oefenprogramma bij patiënten met aspecifieke lagerugpijn (algehele kwaliteit van bewijs laag).

Manipulaties

Naar Samenvatting ›

Manipulaties als monotherapie worden niet aanbevolen.

Details
Van bewijs naar aanbeveling

De onduidelijkheid over klinisch relevante voordelen van manipulaties, het relatief vaak voorkomen van niet-ernstige complicaties en de onbekendheid van complicaties op de lange termijn zijn voor de werkgroep reden om manipulaties niet aan te bevelen als monotherapie bij patiënten met aspecifieke lagerugpijn. Bij patiënten met een wens tot manipulaties, bijvoorbeeld na eerdere goede ervaringen, kunnen manipulaties eventueel in het kader van een verder activerend beleid worden toegepast.

Samenvatting van bewijs: acute pijn
Achtergrond

Het doel van manipulaties is het herstellen en verbeteren van de beweeglijkheid van de (facet)gewrichten van de lumbale wervelkolom. Er wordt onderscheid gemaakt tussen zachtere mobilisatietechnieken en hardere manipulatietechnieken. Bij deze laatste vorm (de zogenoemde high velocity thrust) is doorgaans een knappend geluid hoorbaar in het gewricht (‘kraken’). In Nederland worden deze manipulaties, al dan niet in combinatie met andere (activerende) behandelingstechnieken, o.a. toegepast door manueel therapeuten, chiropractors en orthomanueel geneeskundigen.

Uitgangsvraag

Zijn manipulaties aan te bevelen bij patiënten met acute aspecifieke lagerugpijn (klachtenduur < 12 weken)?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Complicaties

Het systematisch literatuuronderzoek (SR) van Rubinstein et al. (2012) 63 vormt de basis voor de beantwoording van de uitgangsvraag. Bij de aanvullende search (januari 2015) werd één RCT gevonden. 64

Resultaten

Beschrijving onderzoeken

In de SR van Rubinstein 63 werden 20 RCT’s (n = 2674) geïncludeerd waarin de effectiviteit van manipulatie ten opzichte van bijvoorbeeld sham-manipulatie (waarbij de indruk gewekt wordt dat men manipuleert, maar dat in werkelijkheid niet doet) of andere interventies bij volwassenen met acute lagerugpijn op verschillende uitkomstmaten, zoals pijn en functionaliteit, werd onderzocht.

In de RCT (n = 63) van Cruser werden militairen (18-35 jaar) met een nieuwe episode van aspecifieke lagerugpijn gerandomiseerd naar behandeling met osteopathische manipulaties (1 keer per week gedurende 4 weken) in aanvulling op de gebruikelijke zorg of naar gebruikelijke zorg alleen.

Primaire uitkomstmaten waren pijn (QVAS) en functionaliteit (Roland Morris Disability Questionnaire). De follow-upduur bedroeg 4 weken na de laatste behandeling.

Kwaliteit van bewijs

De kwaliteit van het bewijs in de SR varieerde voor de primaire uitkomstmaten van zeer laag tot matig als gevolg van kans op vertekening (zes trials hadden een lage kans op vertekening), onnauwkeurigheid en inconsistentie.

De kwaliteit van het bewijs van de RCT gevonden bij de update van de literatuur is laag vanwege de kans op vertekening, onder andere als gevolg van het ontbreken van blindering van patiënten, behandelaars en beoordelaars en het selectief beschrijven van resultaten. Daarnaast is er sprake van indirect bewijs. Het betreft een specifieke patiëntengroep (militairen, 18-35 jaar), waardoor de generaliseerbaarheid van de resultaten naar de eerstelijnspopulatie beperkt is.

Effectiviteit

  • Manipulaties vs. andere interventies. In de SR van Rubinstein bleek manipulatie niet effectiever te zijn in vergelijking tot inerte interventies (5 RCT’s), sham-behandeling (1 RCT) of in aanvulling op een andere behandeling op de uitkomstmaten rugpijn, rugpijnspecifieke mate van beperking en mate van ervaren herstel (kwaliteit van bewijs laag tot zeer laag). Ook bleek manipulatie niet effectiever dan andere interventies (kwaliteit van bewijs zeer laag tot matig). Er was geen klinisch relevant voordeel van manipulatie in aanvulling op een andere behandeling in vergelijking tot alleen de andere behandeling op functionaliteit na 1 week (SMD -0,41; 95%-BI -0,73 tot -0,10) (2 RCT’s, kwaliteit van bewijs laag). Er was geen verschil op de langere termijn of op de uitkomstmaat pijn. Ten aanzien van werkverzuim werden geen klinisch relevante verschillen gevonden (1 RCT; RR 1,21; 95%-BI 0,99 tot 1,47) (kwaliteit van bewijs zeer laag).
  • Manipulaties vs. gebruikelijke zorg. In de RCT van Cruser et al. werd een beperkt klinisch relevant effect van osteopathische manipulatie gevonden in vergelijking tot gebruikelijke zorg op de uitkomstmaat ‘pijn op dit moment’ (onderdeel van QVAS) (verschil -1,47 (schaal 0-10); 95%-BI -2,75 tot -0,18) na 2 maanden. Er waren geen significante verschillen op de andere onderdelen van de QVAS en de functionaliteit.
  • Indien de resultaten van deze RCT toegevoegd zouden worden aan het systematische literatuuronderzoek van Rubinstein heeft dit waarschijnlijk geen invloed op de grootte en richting van de effectschattingen.

Complicaties

In de RCT’s die in de SR van Rubinstein et al. werden geïncludeerd werden geen ernstige complicaties vermeld. In de RCT van Cruser et al. werden complicaties niet beschreven.

In een SR werden bijwerkingen van manipulaties onderzocht. 65 Niet-ernstige complicaties, zoals lokale gevoeligheid, toename van pijn, misselijkheid, duizeligheid en vermoeidheid, komen relatief vaak voor (30 tot 61% van de met manipulatie behandelde patiënten rapporteert 1 of meer van deze symptomen). Ernstige complicaties van manipulatie in de lumbale regio, zoals een cauda-equinasyndroom, toename van een eventuele discushernia, optreden van een fractuur of hematoom zijn alleen als case report gerapporteerd. Deze ernstige complicaties zijn waarschijnlijk zeer zeldzaam; er zijn geen exacte gegevens beschikbaar. Er zijn geen gegevens beschikbaar over complicaties op de lange termijn.C

Conclusie

Manipulaties bij acute aspecifieke lagerugpijn (klachtenduur < 12 weken), ten opzichte van inerte interventies, sham-behandeling of in aanvulling op een andere behandeling, geven waarschijnlijk geen klinisch relevante voordelen (kwaliteit van bewijs laag).

Samenvatting van bewijs: chronische klachten
Achtergond

Het doel van manipulaties is het herstellen en verbeteren van de beweeglijkheid van de (facet)gewrichten van de lumbale wervelkolom. Er wordt onderscheid gemaakt tussen zachtere mobilisatietechnieken en hardere manipulatietechnieken. Bij deze laatste vorm (de zogenoemde high velocity thrust) is doorgaans een knappend geluid hoorbaar in het gewricht (‘kraken’). In Nederland worden deze manipulaties, al dan niet in combinatie met andere (activerende) behandelingstechnieken, o.a. toegepast door manueel therapeuten, chiropractors en orthomanueel geneeskundigen.

Uitgangsvraag

Zijn manipulaties aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur ≥ 12 weken)?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Complicaties

De SR van Rubinstein et al. (2011) vormt de basis voor de beantwoording van deze uitgangsvraag. 66 Het NHG heeft een update van de literatuur uitgevoerd in januari 2015. Hierbij werden vier RCT’s gevonden. 67 68 69 70

Resultaten

Beschrijving onderzoeken

In de SR van Rubinstein et al. werden 26 RCT’s (n = 6070) geïncludeerd waarin de effectiviteit van manipulaties werd vergeleken met inerte of sham-(schijn)interventies of andere interventies bij patiënten met chronische aspecifieke lagerugpijn.

In de RCT (n = 210) van Cecchi werden patiënten met chronische aspecifieke lagerugpijn (klachtenduur > 6 maanden) die een polikliniek revalidatiegeneeskunde bezochten gerandomiseerd tussen behandeling volgens de ‘rugschool’ (15 sessies van 1 uur met onder andere informatie, houdings- en rugoefeningen), fysiotherapie (15 sessies van 1 uur, 5 keer per week) of manipulaties (4-6 keer per week gedurende 20 minuten, 4-6 weken). Alle patiënten ontvingen een boekje met uitleg en adviezen. Primaire uitkomstmaten waren de rugpijngerelateerde functionaliteit (Roland Morris Disability Questionnaire (schaal 0-24)) en intensiteit van de pijn (Roland Morris Pain Rating Scale (schaal 0-6)) na afsluiting van de behandeling en na 3, 6 en 12 maanden.

In de RCT van Senna (n = 60) werden patiënten met chronische aspecifieke lagerugpijn (klachtenduur > 6 maanden, gemiddeld 18 maanden) die een polikliniek Revalidatie/Reumatologie bezochten gerandomiseerd tussen sham-manuele therapie (12 sessies gedurende 1 maand), manuele therapie (12 sessies gedurende 1 maand) en gecontinueerde manuele therapie (12 sessies gedurende 1 maand, gevolgd door elke 2 weken gedurende 9 maanden). Primaire uitkomstmaten waren onder andere de functionaliteit (Oswestry disability questionnaire) en pijn (VAS-schaal 0-100).

In de RCT van Haas (n = 391) werden patiënten met chronische lagerugpijn (klachtenduur > 3 maanden, gemiddeld 11,8 jaar) geworven middels internet, e-mails en lokale kranten. Zij werden gerandomiseerd tussen behandeling met manipulaties (6, 12 of 18 sessies, 3 keer per week gedurende 6 weken) of lichte massage. Primaire uitkomstmaten waren intensiteit van de pijn (gemodificeerde Von Korff-schaal 0-100) en functionaliteit (gemodificeerde Von Korff-schaal 0-100) na 12 en 24 maanden.

In de RCT van Balthazard (n = 42) werden volwassenen met chronische aspecifieke lagerugpijn (klachtenduur 12-26 weken) die een polikliniek reumatologie bezochten gerandomiseerd tussen manipulaties gevolgd door actieve oefeningen (8 sessies) en een sham-interventie (niet werkzame echo) gevolgd door actieve oefeningen (8 sessies). Primaire uitkomstmaten waren direct pijnstillend effect (VAS, schaal 0-10), pijn (VAS, schaal 0-10), functionaliteit (Oswestry Disability Index, schaal 0-50) en vermijding (fear avoidance, FABQ) aan het einde van de 8 behandelingen en na 3 en 6 maanden.

Kwaliteit van bewijs

De kwaliteit van het bewijs voor de uitkomstmaten in de systematische review varieerde van zeer laag tot matig als gevolg van kans op vertekening (9 RCT’s hadden een lage kans op vertekening), onnauwkeurigheid en inconsistentie.

De kwaliteit van het bewijs voor de uitkomstmaten in de RCT’s gevonden bij de update van de literatuur is laag tot zeer laag vanwege kans op vertekening (o.a. ontbreken van blindering van patiënten en behandelaars, loss to follow-up en ongelijkheid in patiëntkarakteristieken bij aanvang van de trial) en indirectheid.

Effectiviteit

  • Manipulaties vs. andere interventies. Het systematische literatuuronderzoek van Rubinstein toont een niet-klinisch relevant effect op pijnverlichting (15 RCT’s, gemiddeld verschil -4,16 (schaal 0-100); 95%-BI -6,97 tot -1,36) en functionaliteit na 1 maand (14 RCT’s, SMD -0,22; 95%-BI -0,36 tot -0,07) van manuele therapie in vergelijking tot andere interventies (kwaliteit van bewijs laag, afgewaardeerd in verband met onnauwkeurigheid van het effect en risico op vertekening). De resultaten waren vergelijkbaar indien alleen de 8 RCT’s met een laag risico op vertekening werden geïncludeerd (pijn: 1 maand: MD -2,76; 95%-BI -5,19 tot -0,32; 3 maanden: MD -4,55; 95%-BI -8,68 tot -0,43; 6 maanden: MD -3,07; 95%-BI -5,42 tot -0,71); na 12 maanden was er geen significant verschil. Functionaliteit: 1 maand: SMD -0,17; 95%-BI -0,29 tot -0,06, geen significant verschil na 3, 6 en 12 maanden).
  • Daarnaast gaven manipulaties een significant grotere kans op herstel in vergelijking tot andere interventies na 1 maand (3 RCT’s, matige kwaliteit van bewijs, niet klinisch relevant) en 3 maanden (2 RCT’s, lage kwaliteit van bewijs, matig klinisch relevant) (RR 1,20; 95%-BI 1,04 tot 1,37 resp. RR 1,70; 95%-BI 1,20 tot 2,40).
  • Manipulaties in aanvulling op een andere interventie vs. interventie alleen. Er werden geen klinisch relevante voordelen gevonden op de uitkomstmaat pijn (VAS, schaal 0-100) na 1, 3 en 12 maanden dan de andere interventie alleen (1 maand: 3 RCT’s, lage kwaliteit van bewijs, MD -5,88; 95%-BI -10,85 tot -0,90; 3 maanden: 2 RCT’s, hoge kwaliteit van bewijs, MD -7,23; 95%-BI -11,72 tot -2,74; 12 maanden: 2 RCT’s, hoge kwaliteit van bewijs, MD -3,31; 95%-BI -6,60 tot -0,02). Na 6 maanden was er geen significant verschil (lage kwaliteit van bewijs).
  • Ook was er geen klinisch relevant voordeel op functionaliteit bij patiënten die met manipulaties werden behandeld in aanvulling op een andere behandeling in vergelijking tot patiënten die met die behandeling alleen werden behandeld (1 maand: 2 RCT’s, lage kwaliteit van bewijs, SMD -0,40; 95%-BI -0,73 tot -0,07; 3 maanden: 2 RCT’s, hoge kwaliteit van bewijs, SMD -0,22; 95%-BI -0,38 tot -0,06; 12 maanden: 2 RCT’s, hoge kwaliteit van bewijs, SMD -0,21; 95%-BI -0,34 tot -0,09). Na 6 maanden was er geen significant verschil. Er is bewijs van lage kwaliteit dat de interventiegroep significant en klinisch relevant beter herstelt dan de controlegroep (RR 3,40; 95%-BI 1,12 tot 10,28).
  • Manipulaties vs. sham-therapie of inerte interventies. Er is bewijs van zeer lage kwaliteit dat manipulaties niet effectiever zijn dan sham-therapie of inerte interventies op de uitkomstmaten pijn en functionaliteit.

Update van de literatuur

  • Manipulaties vs. rugschool of fysiotherapie. De RCT van Cecchi toont dat de functionaliteit van patiënten die met manuele therapie werden behandeld bij afsluiting van de behandeling en na 3, 6 en 12 maanden significant meer was verbeterd dan bij patiënten die de ‘rugschool’ volgden of fysiotherapie (RMD-score (schaal 0-24) rugschool, fysiotherapie resp. manipulatie: bij ontslag: 5,9;5,3;1,6; p < 0,001; 3 maanden: 5,3;5,4;2,2; p < 0,001; 6 maanden: 5,4;5,8;2,7; p < 0,001; 12 maanden: 5,3;5,7;2,5; p < 0,001.) Patiënten die met manipulaties werden behandeld hadden significant minder pijn in vergelijking tot de twee controlegroepen na 3, 6 en 12 maanden (Roland Morris Pain Rating Scale (schaal 0-6) rugschool, fysiotherapie resp. manipulatie: 3 maanden: 1,4; 1,5; 0,5; p < 0,0016 maanden: 1,4; 1,4; 0,8; p < 0,001; 12 maanden: 1,3; 1,6; 0,7; p < 0,001.) De werkgroep acht deze verschillen niet tot matig klinisch relevant. Er was geen verschil bij afsluiting van de behandeling.
  • Manipulaties vs. sham-behandeling. In de RCT van Senna hadden patiënten die manipulaties (al dan niet verlengd) ondergingen na 1 maand geen klinisch relevante vermindering in pijn in vergelijking met de patiënten die een sham-behandeling ondergingen (controlegroep 33,2; manuele therapiegroep 29,5; verlengde manuele therapiegroep 29,4; p = 0,0027). Ook was er geen klinisch relevante verbetering van de functionaliteit (32,5 , 24,1 resp. 24,6%; p = 0,0029). Na 10 maanden was de pijn in de groep patiënten die met manipulaties waren behandeld weer bijna terug op het niveau bij aanvang, maar bij de patiënten die ook onderhoudsbehandeling ondergingen bleef de pijnscore verbeteren (controlegroep 38,3; manuele therapiegroep 38,5; verlengde manuele therapiegroep 23,5; p < 0,001). Ook de functionaliteit verbeterde meer in de patiëntengroep die verlengde behandeling onderging ten opzichte van de andere twee groepen (37,4, 34,9 resp. 20,6%; p < 0,001).
  • In de RCT van Balthazard gaf manuele therapie gevolgd door actieve oefentherapie geen klinisch relevante betere pijnverlichting dan sham-therapie gevolgd door actieve oefentherapie (MD -0,8 (schaal 0-10); 95%-BI -1,2 tot -0,3). De invloed op de functionaliteit was, van direct na de behandelingen tot het laatste follow-upmoment na 6 maanden, wel beperkt klinisch relevant (MD -7,14 (schaal 0-50); 95%-BI -12,8 tot -1,52). Er was geen verschil op de uitkomstmaat vermijding (fear avoidance).
  • Manipulaties vs. massage. In de RCT van Haas bleek dat manipulaties ten opzichte van lichte massage een niet-klinisch relevant effect op pijn en functionaliteit hadden. Het grootste effect op pijnverlichting werd gezien bij de patiënten die met 12 manipulatiesessies werden behandeld ten opzichte van de controlegroep na 12 weken (adjusted mean difference (AMD) 8,6 (schaal 0-100); 95%-BI 3,2 tot 14,0). Het grootste verschil wat betreft functionaliteit werd na 52 weken gezien bij patiënten die met 18 sessies manipulaties werden behandeld ten opzichte van de controlegroep (AMD 8,8 (schaal 0-100); 95%-BI 3,3 tot 14,4). Na 24 weken waren er geen klinisch relevante verschillen op de uitkomstmaten pijn en functionaliteit tussen de 3 groepen. Ook was er geen klinisch relevant verschil op de verschillende tijdpunten tussen de groep die met 12 sessies werd behandeld ten opzichte van de groep die met 18 sessies werd behandeld.
  • Indien de resultaten van deze RCT’s toegevoegd zouden worden aan de SR van Rubinstein, heeft dit waarschijnlijk geen invloed op de grootte en richting van de effectschattingen.

Complicaties

In de RCT’s die in de SR van Rubinstein werden geïncludeerd, werden geen ernstige complicaties gemeld.

In de RCT van Haas werden geen complicaties gerapporteerd. In de RCT van Senna werden lokaal ongemak en vermoeidheid gemeld, maar geen ernstige complicaties.

In een SR werden complicaties van manipulaties onderzocht. 65 Niet-ernstige complicaties, zoals lokale gevoeligheid, toename van pijn, misselijkheid, duizeligheid en vermoeidheid, komen relatief vaak voor (30 tot 61% van de met manipulatie behandelde patiënten rapporteert 1 of meer van deze symptomen). Ernstige complicaties van manipulatie in de lumbale regio, zoals een cauda-equinasyndroom, toename van een eventuele discushernia, optreden van een fractuur of hematoom zijn alleen als case report gerapporteerd. Deze ernstige complicaties zijn waarschijnlijk zeer zeldzaam. Er zijn geen exacte gegevens beschikbaar.

Conclusie

Het is onduidelijk of manipulaties tot een klinisch relevante verbetering van pijn en functionaliteit leiden bij chronische aspecifieke lagerugpijn (algehele kwaliteit van bewijs zeer laag tot matig).

Stap 4: Gedragsmatige behandeling

Naar Samenvatting ›

Indien de klachten onvoldoende zijn afgenomen bij een klachtenduur van 12 weken:

  • bespreek de mogelijkheid om gedragsmatige behandeling te volgen
  • betrek daarbij de voorkeuren, wensen en motivatie van de patiënt
  • overleg zo nodig met de therapeut uit stap 3

Indien de patiënt voor gedragsmatige behandeling kiest:

  • verwijs naar een therapeut met expertise op dit gebied, zoals:
    • een psychosomatisch fysio- of oefentherapeut 
    • een gespecialiseerde eerstelijnspsycholoog

Toelichting gedragsmatige behandeling
Gedragsmatige behandeling volgt de benadering van de cognitieve-gedragstherapie, en heeft als doel:

  • het activiteitenniveau van de patiënt verhogen
  • disfunctionele gedachten (attributies en verwachtingen) veranderen
  • copingvaardigheden aanleren
Details
Van bewijs naar aanbeveling

Hoewel een SR uit 2010 geen gunstig effect van gedragsmatige therapie liet zien, laten enkele RCT’s van meer recente datum wisselende effecten zien.

De kosteneffectiviteit van gedragsmatige behandeling bij rugpijn in Nederland is niet onderzocht.

Ondanks het ontbreken van duidelijk gunstige effecten van cognitieve gedragstherapie in onderzoek, is de werkgroep van mening dat verwijzing voor gedragsmatige therapie bij bepaalde patiënten zinvol zou kunnen zijn. Vooral bij patiënten bij wie de huisarts aanwijzingen heeft dat psychosociale factoren van invloed kunnen zijn op het in stand houden van de klachten, bijvoorbeeld bij veel angst voor bewegen of (verergering van de) pijn, geringe motivatie, verkeerde ideeën over de aandoening of de belastbaarheid of bij een werksituatie die mogelijk een belangrijke rol speelt bij het in stand houden van de klachten, acht de werkgroep het wenselijk dat de patiënt hier actief mee aan de slag gaat, al dan niet in het kader van een multidisciplinair behandelprogramma. Voor het slagen van de behandeling is het wenselijk dat de patiënt hiervoor openstaat en de behandelaar voldoende geschoold is in behandeling van deze patiëntengroep. Verwijs de patiënt dan ook naar een therapeut of behandelcentrum met expertise op dit gebied.

Samenvatting van bewijs
Achtergrond

Psychosociale invloeden, zoals geringe motivatie, verkeerde ideeën bij de patiënt over zijn aandoening of over zijn belastbaarheid dan wel angst voor pijn of voor specifieke handelingen, kunnen een rol spelen bij patiënten met aspecifieke lagerugpijn. Bij gedragsmatige behandeling gaat men ervan uit dat pijn en disfunctioneren niet alleen worden beïnvloed door somatische factoren, maar ook door psychologische en sociale factoren. Het is onbekend of een cognitief-gedragstherapeutische benadering, gericht op het verhogen van het activiteitenniveau van de patiënt, het veranderen van disfunctionele gedachten (attributies en verwachtingen) en het aanleren van copingvaardigheden, effectief is bij patiënten met chronische aspecifieke lagerugpijn.

Uitgangsvraag

Is gedragsmatige behandeling aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur ≥ 12 weken)?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Vermijding (fear avoidance)
  • Depressieve klachten

Het systematisch literatuuronderzoek (SR) van Henschke is gebruikt als basis voor de beantwoording van deze uitgangsvraag. 71 Bij de aanvullende search (januari 2015) werden 5 RCT’s gevonden. De eindsearch (januari 2016) leverde een SR van Richmond op. 72 Dit ondersteunt in grote lijnen de beschreven resultaten. De resultaten van dit onderzoek hebben geen invloed op de aanbeveling.

Resultaten

Beschrijving onderzoeken

In de SR van Henschke 71 werden 30 RCT’s (n = 3438) ingesloten. Gedragsmatige behandeling, al dan niet in aanvulling op een andere behandeling bij patiënten met chronische aspecifieke lagerugpijn, werd vergeleken met wachtlijstcontrole of een andere behandeling, zoals standaardzorg of oefentherapie.

Er werden drie vormen van gedragsmatige behandeling onderscheiden: operante behandeling (gebaseerd op de principes van operante conditionering), cognitieve behandeling (gericht op de identificatie en verandering van cognities van patiënten wat betreft pijn en disfunctioneren) en respondente behandeling (gericht op het wijzigen van het fysiologisch responssysteem, bijvoorbeeld door reductie van spierspanning).

Kwaliteit van bewijs

De kwaliteit van bewijs voor de verschillende uitkomstmaten varieerde van zeer laag tot matig als gevolg van kans op vertekening (14 RCT’s (47%) hadden een laag risico op vertekening; slechts 9 onderzoeken (30%) beschreven een adequate randomisatieprocedure in combinatie met concealment of allocation), inconsistentie en onnauwkeurigheid van de resultaten.

De kwaliteit van bewijs van de uitkomstmaten in de 5 RCT’s gevonden bij de update van de literatuur wordt als laag beoordeeld vanwege kans op vertekening, indirect bewijs (alleen in het onderzoek van Lamb et al. is uitsluitend een eerstelijnspopulatie geïncludeerd) en onnauwkeurigheid.

Effectiviteit

Gedragsmatige behandeling vs. wachtlijstcontrole

  • Respondente behandeling met progressieve spierontspanning. Vergeleken met wachtlijstcontrole was er een klinisch relevant voordeel op pijnvermindering op de korte termijn (3 RCT’s, n = 74, verschil -19,77; 95%-BI -34,34 tot -5,20; schaal 0-100) en functionaliteit (3 RCT’s, n = 74, standardised mean difference (SMD) -0,88; 95%-BI -1,36 tot -0,39; kwaliteit van bewijs laag). Er is zeer veel onzekerheid over de effectiviteit (-6,8; 95%-BI -19,73 tot 6,12) op de uitkomstmaat depressie (2 RCT’s, n = 58, kwaliteit van bewijs zeer laag).
  • Respondente behandeling met EMG biofeedback. Er was een effect op pijnvermindering op de korte termijn (3 RCT’s, n = 64, SMD -0,8; 95%-BI -1,32 tot -0,28; kwaliteit van bewijs laag), maar niet op de uitkomstmaat functionaliteit (2 RCT’s, n = 44, SMD -0,17; 95%-BI -1,56 tot 1,22; kwaliteit van bewijs laag).
  • Operante behandeling. Er was, vergeleken met wachtlijstcontrole, een (niet-klinisch relevant) effect op pijnvermindering op de korte termijn (3 RCT’s, n = 153, gewogen gemiddeld verschil -0,43; 95%-BI 0,75 tot -0,11; kwaliteit van bewijs matig) maar niet op de uitkomstmaten functionaliteit (2 RCT’s, n = 87) en depressie (2 RCT’s, n = 103) (kwaliteit van bewijs laag).
  • Cognitieve behandeling. Er was, vergeleken met wachtlijstcontrole, geen effect op de uitkomstmaten pijn (5 RCT’s, n = 87; kwaliteit van bewijs laag), functionaliteit (2 RCT’s, n = 68 kwaliteit van bewijs laag).
  • Combinatie van gedragsmatige behandelingen. Er was, vergeleken met wachtlijstcontrole, een effect (5 RCT’s, n = 239) op pijnvermindering op de korte termijn (SMD -0,60; 95%-BI -0,97 tot -0,22; kwaliteit van bewijs laag), maar geen betere uitkomst op de uitkomstmaten functionaliteit (4 RCT’s, n = 134) of depressie (4 RCT’s, n = 194) (kwaliteit van bewijs resp. laag en zeer laag).

Gedragsmatige behandeling vs. andere behandelingen

  • Gedragsmatige behandeling vergeleken met standaardzorg. Een meta-analyse over 2 RCT’s (n = 330) toont geen voordeel op pijn van gedragsmatige behandeling vergeleken met standaardzorg op de korte termijn (-5,18; 95%-BI -9,79 tot -0,57; schaal 0-100; kwaliteit van bewijs matig). Er waren geen klinisch relevante voordelen op de middellange termijn of op de algehele of rugspecifieke functionaliteit (kwaliteit van bewijs matig).
  • Gedragsmatige behandeling en oefentherapie. Er zijn geen verschillen tussen gedragsmatige behandeling en oefentherapie in groepen op de verschillende uitkomstmaten (2 RCT’s, n = 146, kwaliteit van bewijs laag tot matig). Ook zijn er aanwijzingen dat gedragsmatige behandeling even effectief is als chirurgie op de lange termijn (> 12 maanden) (2 RCT’s, n = 345, kwaliteit van bewijs laag).

Gedragsmatige behandeling als aanvulling op een andere behandeling vs. alleen die behandeling

  • Gedragsmatige behandeling gecombineerd met fysiotherapie en educatie. Er waren geen betere effecten op pijn of functioneren (2 RCT’s, n = 59, kwaliteit van bewijs laag). De effecten zijn ook niet beter indien gedragsmatige behandeling wordt toegevoegd aan een intern/klinisch multidisciplinair pijnbehandelprogramma (2 RCT’s, n = 405, kwaliteit van bewijs matig).
  • In andere onderzoeken werd gedragsmatige behandeling in aanvulling op een educatieve brochure en audiocassette, verschillende vormen van medische behandeling en oefentherapie vergeleken. Als gevolg van heterogeniteit kunnen deze onderzoeken niet worden gepoold.

Update van de literatuur

  • Gedragsmatige behandeling vs. standaardzorg. Lamb 73 onderzocht in een RCT de effectiviteit van cognitieve gedragstherapie (Back Skills training) in een groep (n = 468) versus standaardzorg (n = 233) bij patiënten met aspecifieke lagerugpijn gedurende minstens 6 weken in de huisartsenpraktijk (n = 701). Later werden de resultaten gepubliceerd van de verlengde follow-up na gemiddeld 33,3 maanden. 74 Er is een gunstig effect van cognitieve groepstherapie ten opzichte van geen interventie na 12 en 34 maanden op de uitkomstmaten rugpijngerelateerde mate van beperking (gemiddeld verschil resp. 1,3; 95%-BI 0,56 tot 2,06 en 1,3; 95%-BI 0,27 tot 2,26 (schaal 0-24)), pijn (gemiddeld verschil (12 maanden) 7%; 95%-BI 3,12 tot 10,81%) en vermijding (gemiddeld verschil (12 maanden) 2,9 (schaal 0-24); 95%-BI 1,83 tot 4,03). De klinische relevantie van deze bevindingen acht de werkgroep beperkt.
  • Gedragsmatige behandeling vs. wachtlijstcontrole. In de RCT (n = 156) van Siemonsma 75 werd cognitieve therapie gericht op ziekteperceptie door een getrainde ergo- of fysiotherapeut bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur > 3 maanden) vergeleken met een controlegroep die op de wachtlijst stond. De RCT van Siemonsma toont dat cognitieve therapie gericht op ziekteperceptie tot een beperkt klinisch relevante uitbreiding van lichamelijke activiteiten na 18 weken leidt. Dit verschil wordt omgeven door onnauwkeurigheid (verschil -11,91; schaal 0-100; SD 4,57; 95%-BI -20,95 tot -2,86). Ook op verschillende aspecten van de scorelijst van ziekteperceptie werd een gunstig effect gezien in het voordeel van cognitieve groepstherapie.
  • Gedragsmatige behandeling en oefentherapie vs. oefentherapie. Monticone 76 onderzocht in een RCT (n = 90) de effectiviteit van cognitief gedragsmatige therapie in combinatie met oefentherapie versus alleen oefentherapie bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur > 3 maanden) die verwezen werden naar een gespecialiseerd revalidatiecentrum. De cognitieve therapie vond 1 keer per week plaats gedurende 5 weken en daarna 1 keer per maand gedurende 1 jaar. Er werden significante effecten van cognitieve therapie ten opzichte van alleen oefentherapie gezien op de uitkomstmaten mate van beperking, vermijding en kwaliteit van leven (op de korte en lange termijn), maar de presentatie van de resultaten maakte het beoordelen van de klinische relevantie onmogelijk.
  • Khan 77 onderzocht in een RCT (n = 54) de effectiviteit van operante cognitieve gedragstherapie in combinatie met oefentherapie in vergelijking tot alleen oefentherapie bij tweedelijnspatiënten met chronische aspecifieke lagerugpijn (klachtenduur: 3 maanden tot 2 jaar). Primaire uitkomstmaten waren pijn en mate van beperking. Hoewel er in beide groepen verbetering optrad op beide uitkomstmaten, was er geen significant verschil tussen beide groepen.
  • Gedragsmatige behandeling en oefentherapie vs. manuele therapie. Vibe Fersum 78 onderzocht in een RCT (n = 121) de effectiviteit van de combinatie gedragsmatige behandeling en oefentherapie versus manuele therapie bij patiënten met gedurende minstens 3 maanden aspecifieke lagerugpijn. Gedragsmatige behandeling bleek effectiever dan manuele therapie; er was sprake van een klinisch relevante verbetering van de mate van beperking na 3 en 12 maanden (gemiddeld verschil resp. -9,7 (95%-BI -12,7 tot -6,7) en -8,2 (95%-BI -12,6 tot -3,8) (schaal 0-24)). De klinische relevantie van het effect op pijn ten gunste van de interventiegroep was minder duidelijk (gemiddeld verschil na 3 maanden -2,1 (95%-BI -2,7 tot -1,4) en na 12 maanden -1,3 (95%-BI -2,1 tot -0,5) (schaal 0-10). Ook het effect op vermijdingsgedrag was klinisch relevant zowel na 3 als 12 maanden (lichamelijk resp. -3,6 (95%-BI -5,3 tot -1,9) en -4,7 (95%-BI -6,5 tot -3,0) en werkgerelateerd resp. -5,7 (95%-BI -7,8 tot -3,6) en -5,6 (95%-BI -8,7 tot -2,5) (schaal 0-24)). Patiënten in de interventiegroep verbeterden meer op de uitkomstmaten angst en depressie na 3 en 12 maanden (gemiddeld verschil respectievelijk -0,12 (schaal 1-4) (95%-BI -0,19 tot -0,04) en -0,13 (95%-BI -0,22 tot -0,04)).

De werkgroep verwacht dat, indien de resultaten van de update van de literatuur toegevoegd zouden worden aan de SR van Henschke, dit mogelijk consequenties zou hebben voor de kwaliteit van bewijs vanwege toegenomen precisie van de resultaten. Daarnaast zou de grootte van de effectschattingen (iets gunstiger effect van cognitieve gedragsmatige behandeling) kunnen veranderen. De werkgroep verwacht echter niet dat er hierdoor andere conclusies zouden worden getrokken over het bestaan van klinisch relevante voor- of nadelen van gedragsmatige behandeling ten opzichte van andere behandelingen.

Complicaties

Complicaties van cognitieve gedragsmatige behandeling werden niet beschreven of traden niet op.

Zie voor de risk of biastabellen en de studiekarakteristieken van de RCT’s het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is onduidelijk of er klinisch relevante voordelen zijn van cognitieve gedragsmatige behandeling ten opzichte van wachtlijst- of standaardbehandeling bij patiënten met chronische aspecifieke lagerugpijn (algehele kwaliteit van bewijs laag tot zeer laag).

Stap 5: Multidisciplinaire revalidatie

Naar Samenvatting ›

Indien een patiënt met chronische klachten voldoende gemotiveerd is en oefentherapie en gedragsmatige behandeling onvoldoende effectief zijn geweest:

  • verwijs naar een multidisciplinair revalidatieprogramma 

Verwijzing voor deze gespecialiseerde behandeling is vooral zinvol bij de volgende 3 factoren:

  • de patiënt is nog niet teruggekeerd in het arbeidsproces
  • hoge ziektelast
  • vermoedelijk beïnvloeden psychosociale factoren het in stand houden van de klachten

Toelichting multidisciplinaire revalidatie 
Multidisciplinaire revalidatie bestaat uit een combinatie van educatieve, fysieke, gedragsmatige en/of arbeidsgerelateerde interventies. Hierbij zijn verschillende disciplines betrokken, zoals een revalidatiearts, een psycholoog, en een fysio- of oefentherapeut. De behandeling wordt aangeboden in gespecialiseerde behandel-/revalidatiecentra. De doelen zijn:

  • functioneren verbeteren
  • beter leren omgaan met de rugpijn
Details
Van bewijs naar aanbeveling

De effecten van multidisciplinaire revalidatieprogramma’s gebaseerd op het biopsychosociale model zijn klein, de behandeling is intensief, kostbaar en beperkt beschikbaar.

Daarnaast is de kosteneffectiviteit van deze behandelprogramma’s op de lange termijn niet goed onderzocht. In een kosteneffectiviteitsonderzoek, uitgevoerd in Nederland, werd een multidisciplinair behandelprogramma gericht op arbeidsre-integratie, bestaande uit een graded activity programma gebaseerd op cognitieve gedragsmatige principes en een interventie op de arbeidsvloer, vergeleken met gebruikelijke zorg. Het behandelprogramma (follow-upduur 1 jaar) bleek kosteneffectief (£13,165 (€ 17340) vs. £18,475 (€ 24334)). 79 Op grond van bovenstaande beperkingen is het advies om alleen patiënten met chronische aspecifieke lagerugpijn met een hoge ziektelast, waarbij de huisarts het vermoeden heeft dat psychosociale factoren van invloed zijn op het in stand houden van de klachten, te verwijzen voor een multidisciplinair revalidatieprogramma. Het is van belang om te beoordelen of de patiënt voldoende gemotiveerd is tot het ondergaan van een dergelijk intensief behandelprogramma. Er zijn in Nederland diverse vormen van multidisciplinaire rugteams operationeel. De teamsamenstelling en werkwijze hangen af van de beschikbaarheid van professionals, specifieke deskundigheid en regionale, lokale en organisatiegebonden factoren.

Samenvatting van bewijs
Achtergrond

Multidisciplinaire revalidatieprogramma’s bestaan uit een combinatie van educatieve, fysieke, gedragsmatige en/of arbeidsgerelateerde interventies waarbij verschillende disciplines, zoals een arts, psycholoog en fysiotherapeut, betrokken zijn. Bij de behandeling wordt uitgegaan van het biopsychosociale model, waarbij het ontstaan en in stand houden van chronische lagerugpijn wordt toegeschreven aan een samenspel van biomedische (bijv. spierkracht, conditie), psychologische (bijv. angst, stress, coping) en sociale factoren (bijv. werk). De behandeling is vooral gericht op het verbeteren van het functioneren van de patiënt en het beter leren omgaan met de rugpijn. Het is de vraag of dit soort, vaak intensieve en dure, programma’s effectief zijn bij patiënten met chronische aspecifieke lagerugpijn.

Uitgangsvraag

Zijn multidisciplinaire revalidatieprogramma’s aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur ≥ 12 weken)?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Arbeidsverzuim

Het systematisch literatuuronderzoek (SR) van Kamper et al. (2014) 80 vormt de basis voor de beantwoording van deze uitgangsvraag. De aanvullende search leverde geen RCT’s op.

Resultaten

Beschrijving onderzoeken

In de SR van Kamper werden 41 RCT’s (n = 6858) geïncludeerd waarin de effectiviteit van multidisciplinaire revalidatie, uitgaande van het biopsychosociale model, in vergelijking tot gebruikelijke zorg, wachtlijstcontrole of andere behandelingen, werd onderzocht. In de meeste geïncludeerde onderzoeken waren de patiënten gemiddeld tussen de 40 en 45 jaar oud en hadden ze gemiddeld langer dan een jaar klachten van lagerugpijn. In 15 RCT’s was de interventie intensief (> 100 uur en dagelijks contact). De onderzoeken werden verricht in revalidatieklinieken, waar patiënten vanuit de eerste lijn, tweede lijn of verzekeringsmaatschappij naar verwezen waren.

Kwaliteit van bewijs

De kwaliteit van het bewijs voor de uitkomstmaten in het systematische literatuuronderzoek varieert van laag tot matig als gevolg van kans op vertekening (32% van de onderzoeken had een lage kans op vertekening), onnauwkeurigheid, indirect bewijs op het niveau van de interventie en inconsistentie.

Effectiviteit

  • Multidisciplinaire revalidatie vs. gebruikelijke zorg. Er is bewijs van matige kwaliteit dat er geen klinisch relevant voordeel bestaat van multidisciplinaire revalidatie in vergelijking met gebruikelijke zorg op de pijn (7 RCT’s, n = 821, SMD 0,21; 95%-BI 0,04 tot 0,37; equivalent aan 0,5 punten op schaal 0-10) en functionaliteit (6 RCT’s, n = 722; SMD 0,23; 95%-BI 0,06 tot 0,40; equivalent aan 1,5 punt op schaal 0-24). Er is geen significant verschil op de uitkomstmaat arbeidsverzuim (7 RCT’s, n = 1360, kwaliteit van bewijs matig).
  • Op grond van een subgroepanalyse kan geen uitspraak worden gedaan over de invloed van de ernst van de symptomen bij inclusie. De intensiteit van de behandeling lijkt geen invloed te hebben op de uitkomst.
  • Multidisciplinaire revalidatie vs. fysieke behandelingen. Er is geen significant verschil op de uitkomstmaat pijn (9 RCT’s, n = 872). De functionaliteit verbeterde significant (en was beperkt klinisch relevant) meer met multidisciplinaire behandeling (10 RCT’s, n = 1169, SMD 0,68; 95%-BI 0,16 tot 1,19). Ook is de kans om weer aan het werk te zijn 1 jaar na de behandeling groter na het doorlopen van het revalidatieprogramma (OR 1,87; 95%-BI 1,39 tot 2,53, kwaliteit van bewijs matig). Dit verschil in arbeidsverzuim acht de werkgroep klinisch relevant.
  • Multidisciplinaire revalidatie vs. chirurgie. Er is bewijs van lage kwaliteit (2 RCT’s, n = 423) dat multidisciplinaire revalidatie geen klinisch relevant voordeel biedt vergeleken met chirurgie op de uitkomstmaten pijn, functionaliteit en arbeidsverzuim.
  • Multidisciplinaire revalidatie vs. wachtlijstcontrole. Er is bewijs van lage kwaliteit (3 RCT’s, n = 213) dat multidisciplinaire behandeling ten opzichte van wachtlijstcontrole een klinisch relevant voordeel heeft op pijn op de korte termijn (termijn niet gedefinieerd; SMD 0,73; 95%-BI 0,24 tot 1,22) en functionaliteit (SMD 0,49; 95%-BI 0,22 tot 0,76).

Bijwerkingen

In de RCT’s waarin bijwerkingen werden beschreven werden geen bijwerkingen van multidisciplinaire behandeling gerapporteerd.

Conclusie

Het is onduidelijk of multidisciplinaire behandelprogramma’s die gebaseerd zijn op het biopsychosociale model in vergelijking tot gebruikelijke zorg, wachtlijstcontrole, chirurgie en fysieke behandelingen leiden tot klinisch relevante verbeteringen op de uitkomstmaten pijn en functionaliteit (kwaliteit van bewijs laag tot matig). Het is aannemelijk dat deze programma’s in vergelijking tot fysieke behandelingen bij chronische aspecifieke lagerugpijn leiden tot een snellere terugkeer op de arbeidsmarkt (kwaliteit van bewijs matig).

Zelfmanagement

Naar Samenvatting ›

Bij chronische of steeds recidiverende klachten:

  • bespreek de wijze waarop de patiënt zelfstandig keuzes kan maken bij dagelijkse bezigheden die mogelijk beïnvloed worden door de rugpijn
  • bespreek hoe de patiënt kan leren omgaan met de symptomen en met de lichamelijke, sociale en psychische gevolgen van de klachten

Een individueel zorgplan opstellen kan voor sommige patiënten met chronische klachten nuttig zijn, zie Handreiking Gezamenlijke besluitvorming over doelen en zorgafspraken.

Details
Zelfmanagement

Onder zelfmanagement wordt verstaan: ‘het omgaan met symptomen, behandeling, lichamelijke, psychische en sociale consequenties van de chronische aandoening en/of de omgang met risicofactoren en aanpassing in leefstijl.’ Recent werd de NHG-Zorgmodule Leefstijl Bewegen gepubliceerd, waarin veel aandacht wordt geschonken aan zelfmanagement bij chronische klachten.

Als gevolg van heterogeniteit in de zelfmanagementstrategieën en controle-interventies in het beschikbare onderzoek bij aspecifieke lagerugpijn, werd afgezien van een systematische samenvatting van de literatuur. De effectiviteit van zelfmanagement bij aspecifieke lagerugpijn is onzeker.

De werkgroep is van mening dat het bij chronische klachten zinvol kan zijn om zelfmanagement te bevorderen. De huisarts kan dit doen door educatie en het begeleiden van een actieve leefstijl. Doel hiervan is dat de patiënt zelfstandig keuzes maakt bij dagelijkse bezigheden die mogelijk beïnvloed worden door de rugpijn en dat de patiënt leert omgaan met de symptomen en lichamelijke, sociale en psychische gevolgen van de aandoening. Hiertoe kan het opstellen van een individueel zorgplan bij sommige patiënten met chronische klachten zinvol zijn. Zie ook de NHG-Zorgmodule Leefstijl Bewegen en de Handreiking Gezamenlijke besluitvorming over doelen en zorgafspraken op www.nhg.org/actueel/dossiers/dossier-persoonsgerichte-zorg).

Naar Samenvatting ›

Indien er chronische klachten zijn en de aanpak volgens het stappenplan heeft niet tot het beoogde resultaat geleid, zie:  

Medicamenteuze behandeling

Naar Samenvatting ›

Pijnmedicatie

Naar Samenvatting ›

Bespreek de mogelijkheid van analgetica ter ondersteuning van het activerende beleid. De werkzaamheid van analgetica ten aanzien van pijn en functionaliteit bij aspecifieke lagerugpijn is waarschijnlijk beperkt. Schrijf de analgetica voor conform het stappenplan uit NHG-Standaard Pijn. 

Voor de behandeling van aspecifieke lagerugpijn gelden specifiek de volgende aanbevelingen:

  • Paracetamol kan zowel tijdcontingent als naar behoefte worden voorgeschreven; er is geen verschil in effectiviteit.
  • NSAID’s zijn waarschijnlijk niet effectiever dan paracetamol bij lagerugpijn.
  • Dermale NSAID’s, zoals diclofenacgel 1-3% of ibuprofengel 5%, kunnen als alternatief dienen voor orale NSAID’s. Dermale varianten gaan minder vaak gepaard met systemische bijwerkingen en kunnen daardoor ook door ouderen met een verminderde nierfunctie of hartfalen gebruikt worden (mits de huid intact is).
  • Behandel alleen patiënten met hevige, acute lagerugpijn bij wie zwakker werkende analgetica niet effectief waren met opiaten. Informeer de patiënt over de bijwerkingen en houd de behandelduur zo kort mogelijk (maximaal 5 dagen).
  • Behandel alleen patiënten met chronische aspecifieke lagerugpijn met ernstige beperkingen met zwak- of sterkwerkende opiaten met als doel het stapsgewijs uitbreiden van activiteiten te ondersteunen. Houd in dit geval de behandelduur zo kort mogelijk, maximaal 1 tot 2 weken.
Details
Van bewijs naar aanbeveling

Paracetamol

Op basis van beperkt onderzoek lijken er geen duidelijk verschillen te zijn tussen paracetamol en de andere behandelingen (geen paracetamol (incl. placebo), NSAID’s of antidepressiva). De werkgroep verwacht dat sommige patiënten toch een voorkeur zullen hebben voor het gebruik van een analgeticum. Paracetamol is een relatief goedkoop en vrij verkrijgbaar geneesmiddel. Daarnaast heeft het een breed veiligheidsprofiel en is er zeer ruime klinische ervaring mee opgedaan (zie NHG-Standaard Pijn). De werkgroep is van mening dat er geen reden is om een ander analgeticum als eerste voorkeur voor te schrijven en daarmee af te wijken van de aanbevelingen in de NHG-Standaard Pijn, waarin wordt aanbevolen de pijn stapsgewijs te behandelen, gebaseerd op de pijnladder van de WHO. Indien patiënten de voorkeur geven aan het gebruik van een analgeticum, kan ook een kortdurende behandeling met paracetamol (voldoende hoog gedoseerd) overwogen worden ter ondersteuning van de activerende aanpak. Indien de patiënt na een paar dagen geen effect bemerkt, adviseert de huisarts de behandeling met paracetamol te staken.

NSAID’s

Gezien de geringe voordelen van NSAID’s ten opzichte van placebo bij zowel acute als chronische aspecifieke lagerugpijn en het risico op onder andere cardiovasculaire en gastro-intestinale bijwerkingen van het gebruik van NSAID’s, wordt het voorschrijven van NSAID’s niet standaard aanbevolen bij de behandeling van aspecifieke lagerugpijn. COX-2-selectieve NSAID’s worden niet aanbevolen vanwege een hoger risico op cardiovasculaire complicaties zonder aangetoonde voordelen ten opzichte van de klassieke NSAID’s gecombineerd met een protonpompremmer. Indien de patiënt toch een sterke voorkeur heeft voor toepassing van NSAID’s, bespreek dan dat de voordelen waarschijnlijk gering zijn en er een risico bestaat op het optreden van bijwerkingen.

In de NHG-Standaard Pijn worden dermale NSAID’s aanbevolen bij acute spier- en gewrichtspijn. Directe vergelijking van een dermaal met een oraal NSAID bij acute spier- en gewrichtspijn liet geen verschil in werkzaamheid zien tussen beide toepassingen. Daarnaast is diclofenacgel equivalent aan orale NSAID’s op de uitkomstmaat vermindering van pijn als gevolg van knie- en handartrose, maar er is geen bewijs voor andere chronische pijnsyndromen. Dermale NSAID’s geven vergeleken met placebo vaker (doorgaans lichte en voorbijgaande) lokale bijwerkingen, maar zijn minder sterk geassocieerd met systemische bijwerkingen dan orale NSAID’s en kunnen daardoor ook door ouderen met verminderde nierfunctie of hartfalen gebruikt worden (mits de huid intact is) (zie voor de onderbouwing NHG-Standaard Pijn).

Alhoewel onderzoek naar de effectiviteit van dermale NSAID’s, zoals diclofenacgel 1-3% of ibuprofengel 5%, bij acute lagerugpijn zeer beperkt is, kunnen dermale NSAID’s, op grond van de onderbouwing bij acute spier- en gewrichtspijn en het gunstiger bijwerkingenprofiel, als alternatief dienen voor orale NSAID’s bij acute lagerugpijn.

Houd, indien orale behandeling gewenst is, rekening met specifieke patiëntkenmerken (comorbiditeit, voorgeschiedenis van cardiovasculaire of gastro-intestinale aandoeningen, respons op eerder voorgeschreven NSAID’s) bij de keuze voor naproxen, ibuprofen of diclofenac. Zie voor de dosering, contra-indicaties en de indicatie voor maagprotectie de NHG-Standaard Maagklachten.

Opiaten bij acute lagerugpijn

Er zijn geen SR’s of RCT’s gevonden naar de effectiviteit van opiaten bij acute lagerugpijn (klachtenduur < 12 weken). Nadelen van behandeling met opiaten zijn de grotere kans op bijwerkingen en het risico op verslaving, gewenning en dosisescalatie. Daarnaast bestaat er een dosisafhankelijk risico op (ernstige) bijwerkingen (zie NHG-Standaard Pijn). Bovendien zijn er aanwijzingen dat behandeling met opiaten bij acute lagerugpijn gepaard gaat met een langere duur tot herstel en slechter functioneren op de lange termijn. Op grond hiervan adviseert de werkgroep om alleen bij hevige pijn bij wie zwakker werkende analgetica niet effectief waren, opiaten voor te schrijven. Houd in dit geval de behandelduur zo kort mogelijk (maximaal 5 dagen).

Opiaten bij chronische lagerugpijn

Er worden voordelen gezien in pijnvermindering door de behandeling met opiaten (gedurende ten minste 1 maand) en beperkte voordelen op de functionaliteit bij patiënten met chronische lagerugpijn. De werkgroep beveelt op grond van de hierboven beschreven nadelen en risico’s van behandeling met opiaten aan om terughoudend te zijn met het voorschrijven van opiaten bij chronische pijn. Het advies is om alleen patiënten met ernstige beperkingen met zwak- of sterkwerkende opiaten te behandelen. Houd in dit geval de behandelduur zo kort mogelijk, bijvoorbeeld maximaal 1-2 weken (zie NHG-Standaard Pijn).

Algemeen

De werkzaamheid van pijnmedicatie bij (acute en chronische) lagerugpijn is beperkt. De basis van de behandeling bij lagerugpijn bestaat uit voorlichting en adviezen om in beweging te komen of te blijven. Indien de patiënt, ter ondersteuning van deze activerende aanpak, de voorkeur geeft aan behandeling met analgetica adviseert de werkgroep om het stappenplan in de NHG-Standaard Pijn, waarin wordt aanbevolen de pijn stapsgewijs te behandelen, gebaseerd op de pijnladder van de WHO, te volgen. Bij onvoldoende effectiviteit van paracetamol kunnen dermale NSAID’s als alternatief voor behandeling met orale NSAID’s worden voorgeschreven. Dermale NSAID’s gaan minder vaak gepaard met systemische bijwerkingen dan orale NSAID’s. Behandeling met opiaten dient slechts bij uitzondering plaats te vinden op grond van de beperkte werkzaamheid en het risico op verslaving, gewenning en dosisescalatie. Daarnaast bestaat er een dosisafhankelijk risico op (ernstige) bijwerkingen. Behandel patiënten met acute lagerugpijn slechts bij uitzondering met opiaten. Overweeg alleen bij patiënten met hevige pijn bij wie zwakker werkende analgetica niet effectief waren om opiaten voor te schrijven. Houd in dit geval de behandelduur zo kort mogelijk (maximaal 5 dagen). Behandel in geval van chronische aspecifieke lagerugpijn met zwak- of sterkwerkende opiaten, indien de pijn gepaard gaat met ernstige beperkingen, met als doel het stapsgewijs uitbreiden van activiteiten te vergemakkelijken. Houd in dit geval de behandelduur zo kort mogelijk, maximaal 1-2 weken.

Samenvatting van bewijs: paracetamol
Achtergond

Paracetamol wordt frequent voorgeschreven aan patiënten met aspecifieke lagerugpijn, mede op basis van het relatief gunstige bijwerkingenprofiel. De effectiviteit van paracetamol bij aspecifieke lagerugpijn is echter onduidelijk.

Uitgangsvraag

Is paracetamol aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Bijwerkingen

Het systematisch literatuuronderzoek (SR) van Davies vormt de basis voor de beantwoording van deze uitgangsvraag. 81 De aanvullende search leverde 1 RCT op. 82

Resultaten

Beschrijving onderzoeken

In de SR van Davies werden 7 RCT’s (n = 676) geïncludeerd waarin het effect van paracetamol in vergelijking tot geen behandeling, placebo of een andere behandeling bij patiënten > 16 jaar met aspecifieke lagerugpijn werd onderzocht.

In de RCT (n = 1652) van Williams werd de effectiviteit onderzocht van een vaste dosering van 3990 mg paracetamol per dag, in vergelijking tot paracetamol naar behoefte (maximaal 4000 mg/dag) of placebo bij patiënten met acute lagerugpijn (klachtenduur < 6 weken), al dan niet met uitstraling in de benen, die zich meldden bij een huisartsenpraktijk of reageerden op een advertentie. Alle deelnemers kregen op richtlijn gebaseerde adviezen met leefregels om actief te blijven en bedrust te vermijden. De primaire uitkomstmaat was tijd tot herstel. Herstel werd gedefinieerd als een pijnscore van 0 of 1 op een schaal van 0-10 gedurende ten minste 7 aaneengesloten dagen. Secundaire uitkomstmaten waren pijnintensiteit, mate van beperking, functionaliteit, mate van ervaren herstel, slaapkwaliteit en kwaliteit van leven. Ook werden de tevredenheid met de behandeling, de blindering en het optreden van bijwerkingen geregistreerd. De follow-upduur bedroeg 3 maanden. In de interventiegroep namen de patiënten minder paracetamol in dan de voorgeschreven dosering (3990 mg/dag). In de eerste week was de mediane ingenomen dosis 3500 mg, in de tweede week 2800 mg. De dosering paracetamol die patiënten innamen die in de ‘zo nodig’ groep waren ingedeeld varieerde van 1000 mg/dag in week 1 tot 500 mg/dag in het vervolg van het onderzoek.

Kwaliteit van bewijs

  • De kwaliteit van het bewijs in het literatuuronderzoek van Davies voor de verschillende uitkomstmaten varieerde van laag tot zeer laag, als gevolg van kans op vertekening (er was bijvoorbeeld slechts in 1 van de 7 onderzoeken geen sprake van concealment of allocation en in 2 van de 7 onderzoeken waren deelnemers en behandelaars geblindeerd) en onnauwkeurigheid (slechts 1 trial includeerde meer dan 25 deelnemers per behandelgroep).
  • De kwaliteit van het bewijs in de RCT van Williams was hoog voor de uitkomstmaten pijn en functionaliteit.
  • De kwaliteit van bewijs was laag tot zeer laag voor het bestaan van bijwerkingen bij lagerugpijn, omdat deze bijwerkingen onvoldoende zijn onderzocht.

Effectiviteit

  • Paracetamol vaste dosering vs. paracetamol naar behoefte vs. placebo bij acute lagerugpijn. Er was geen klinisch relevant verschil tussen de behandelgroepen (mediane tijd tot herstel in de 3 groepen varieerde van 16 tot 17 dagen) (kwaliteit van bewijs hoog). Ook na 12 weken werd er geen verschil in herstel tussen de groepen gevonden (kwaliteit van bewijs hoog). Er werden geen verschillen in pijnscore op de verschillende tijdstippen gezien (kwaliteit van bewijs hoog). Ook op de andere secundaire uitkomstmaten werd geen significant verschil aangetoond. 82
  • Paracetamol vs. geen paracetamol bij acute lagerugpijn. In de review van Davies vond men geen verschil in herstel tussen behandeling met paracetamol 3000 mg/dag en geen behandeling bij patiënten met acute lagerugpijn (1 RCT, n = 46, kwaliteit van bewijs laag (grote kans op vertekening, indirectheid, imprecisie)).
  • Paracetamol vs. NSAID’s. In 4 RCT’s (3 acute lagerugpijn en 1 chronische lagerugpijn) werd paracetamol vergeleken met NSAID’s. In geen van deze trials werd een significant verschil in vermindering van pijn of functionaliteit gevonden (kwaliteit van bewijs laag (grote kans op vertekening, indirectheid en imprecisie)).
  • Paracetamol vs. antidepressiva (amitriptyline). In één RCT (n = 45) waarin paracetamol 2000 mg/dag met amitriptyline 37,5 mg/dag werd vergeleken bij patiënten met acute en chronische lagerugpijn bleek dat paracetamol minder effectief was dan amitriptyline; dit effect was alleen in week 4 van de behandeling significant (gewogen gemiddeld verschil 1,5; 95%-BI 0,1 tot 2,9; kwaliteit van bewijs was matig vanwege onnauwkeurigheid). 81

Bijwerkingen

Bijwerkingen werden in het systematische literatuuronderzoek van Davies niet gerapporteerd. In de RCT van Williams meldde 19% van de deelnemers bijwerkingen en 1% ernstige bijwerkingen. Deze percentages waren gelijk in de drie behandelgroepen. Onderzoeken naar het optreden van bijwerkingen van paracetamol, voorgeschreven voor andere indicaties, lieten zien dat er bij veelvuldig gebruik van paracetamol mogelijk een verhoogd risico is op cardiovasculaire, gastro-intestinale en renale bijwerkingen. De kwaliteit van het bewijs was echter zeer laag (zie NHG-Standaard Pijn).

Conclusie
  • Er is onduidelijkheid over het bestaan van klinisch relevante voordelen van paracetamol vergeleken met het niet gebruiken van paracetamol, placebo, NSAID’s of antidepressiva (amitriptyline) bij aspecifieke lagerugpijn (algehele kwaliteit van bewijs laag).
  • Het is vrijwel zeker dat een vaste dosering paracetamol niet effectiever is dan paracetamol naar behoefte of placebo (kwaliteit van bewijs hoog).
  • Het is zeer onduidelijk of paracetamol een verhoogd risico op cardiovasculaire en gastro-intestinale bijwerkingen geeft (kwaliteit van bewijs zeer laag).
Samenvatting van bewijs: NSAID's
Achtergrond

NSAID’s worden frequent voorgeschreven aan patiënten met aspecifieke lagerugpijn. Het veronderstelde werkingsmechanisme ligt in de pijnstillende en/of ontstekingsremmende werking.

Uitgangsvraag

Zijn NSAID’s aan te bevelen aan patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Ernst van de rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Bijwerkingen

Het systematisch literatuuronderzoek (SR) van Roelofs vormt de basis voor de beantwoording van deze uitgangsvraag. 83 De aanvullende search leverde geen RCT’s op.

​​​​​​​Resultaten

Beschrijving onderzoeken

In de SR van Roelofs werden 65 RCT’s (n = 11.237) geïncludeerd, waarin de effectiviteit van NSAID’s ten opzichte van placebo of een andere behandeling bij aspecifieke lagerugpijn werd onderzocht. Ook werd onderzocht welke soort NSAID het meest effectief was.

Kwaliteit van bewijs

De kwaliteit van het bewijs in de SR van Roelofs voor de verschillende uitkomstmaten varieerde van laag tot matig. Er werden 28 onderzoeken met een lage kans op vertekening (beoordeeld met de criteria van de Cochrane Back Review Group) geïncludeerd. De bewijskracht van de overige 37 onderzoeken werd vooral verlaagd door het ontbreken van een adequate randomisatieprocedure en concealment of allocation, onvoldoende compliance en een te korte follow-upperiode. Verder was er sprake van indirect bewijs (ook tweedelijnspopulaties) en onnauwkeurigheid (laag aantal patiënten per vergelijking).

Effectiviteit

  • NSAID’s vs. placebo bij acute lagerugpijn. In 11 RCT’s (waarvan 7 met een lage kans op vertekening) werden NSAID’s met placebo vergeleken. Behandeling met NSAID’s verbeterde het door de patiënt ervaren herstel meer dan placebo (7 RCT’s, n = 954, gepoolde RR 1,19; 95%-BI 1,07 tot 1,33; kwaliteit van bewijs matig). Behandeling met NSAID’s verminderde de pijn meer dan placebo (3 RCT’s, n = 577, WMD -7,69; 95%-BI -12,08 tot -3,30 (schaal 0-100)). Deze bevindingen zijn van beperkte klinische relevantie.
  • NSAID’s vs. placebo bij chronische lagerugpijn. In 4 RCT’s (n = 1020; kwaliteit van bewijs matig) werden NSAID’s met placebo vergeleken. Behandeling met NSAID’s was effectiever dan placebo op de uitkomstmaat pijn (gepoolde WMD -12,40; 95%-BI -15,33 tot -9,26 (schaal 0-100); kwaliteit van bewijs matig). Deze bevinding is van beperkte klinische relevantie.
  • NSAID’s vs. paracetamol. In 6 RCT’s (waarvan 1 met een lage kans op vertekening) werd de effectiviteit van NSAID’s met paracetamol vergeleken. Er is bewijs van matige kwaliteit dat NSAID’s even effectief zijn als paracetamol op de uitkomstmaten pijn en algehele verbetering bij patiënten met acute en chronische lagerugpijn.
  • NSAID’s vs. andere medicatie. In 5 RCT’s (n = 451), waarvan 1 met lage kans op vertekening, werd geen verschil in effectiviteit tussen NSAID’s, narcotica en spierrelaxantia gevonden bij acute lagerugpijn (kwaliteit van bewijs matig).
  • NSAID’s vs. niet-medicamenteuze behandeling. In 4 RCT’s met lage kans op vertekening werden NSAID’s vergeleken met andere behandelingen, zoals fysiotherapie, manuele therapie en bedrust. In 1 onderzoek (n = 110, kwaliteit van bewijs laag) werd een beperkt klinisch relevant verschil ten gunste van NSAID’s en bedrust ten opzichte van bedrust gevonden (percentage verbetering 86 vs. 70%). Er was geen verschil in effectiviteit tussen NSAID’s in vergelijking tot fysio- en oefentherapie in de acute fase.
  • NSAID’s vs. NSAID’s. In 33 RCT’s maakte men een onderlinge vergelijking tussen verschillende NSAID’s bij acute lagerugpijn. Er is bewijs van matige kwaliteit dat NSAID’s, inclusief de COX-2-selectieve NSAID’s, onderling niet in effectiviteit verschillen bij acute en chronische lagerugpijn. Ook is er geen verschil in aantal en ernst van de bijwerkingen tussen de NSAID’s, met uitzondering van de COX-2-selectieve NSAID’s. In deze trials gaven deze minder vaak aanleiding tot het optreden van bijwerkingen (vooral gastro-intestinaal) dan de traditionele NSAID’s (4 RCT’s, n = 1059, RR 0,83; 95%-BI 0,70 tot 0,99). In 1 RCT werd een dermaal NSAID (felbinac foam) vergeleken met een oraal ibuprofen en in 1 RCT werden twee dermale NSAID’s met elkaar vergeleken (ibuprofengel vs. indomethacinepleister). Ook in deze twee RCT’s werd er geen verschil in effectiviteit tussen de onderzochte middelen gevonden.

Bijwerkingen

  • NSAID’s vs. placebo. Behandeling met NSAID’s gaf vaker aanleiding tot bijwerkingen dan placebo (acuut: 10 RCT’s, n = 1852, gepoolde RR 1,35; 95%-BI 1,09 tot 1,69; kwaliteit van bewijs matig); chronisch: 4 RCT’s, n = 1020, gepoolde RR 1,24; 95%-BI 1,07 tot 1,43; kwaliteit van bewijs matig).
  • NSAID’s vs. paracetamol. NSAID’s gaven vaker aanleiding tot bijwerkingen dan paracetamol (3 RCT’s, n = 309, RR 1,76; 95%-BI 1,12 tot 2,76).
  • Uit grootschalig onderzoek naar de veiligheid van NSAID’s bij verschillende patiëntengroepen en verschillende indicaties blijkt dat NSAID’s, met uitzondering van naproxen, naar alle waarschijnlijkheid het risico verhogen op het optreden van veneuze thrombo-embolische gebeurtenissen. Dit risico is afhankelijk van de toegepaste dosering, ook bij kortdurend gebruik.
  • Ook geven zij een verhoogd risico op andere cardiovasculaire en gastro-intestinale complicaties. De klassieke NSAID’s (naproxen, ibuprofen en diclofenac) en de COX-2-selectieve NSAID’s (celecoxib) beïnvloeden de nierfunctie in gelijke mate nadelig. Bij verminderde nierfunctie kan het gebruik van alle NSAID’s leiden tot acute nierinsufficiëntie of water- en zoutretentie, waardoor hartfalen en hypertensie kunnen ontstaan of verergeren.
  • De COX-2-selectieve NSAID’s geven minder gastro-intestinale complicaties dan de klassieke NSAID’s, maar geven in ongeveer gelijke mate aspecifieke maagklachten (maagpijn). Zij geven echter een hoger risico op cardiovasculaire complicaties (zie NHG-Standaard Pijn).

 

Conclusie
  • Het gunstige effect van NSAID’s ten opzichte van placebo is gering en van beperkte klinische relevantie bij patiënten met aspecifieke lagerugpijn, ongeacht de klachtenduur. NSAID’s zijn niet effectiever dan paracetamol bij patiënten met aspecifieke lagerugpijn (acuut en chronisch) (kwaliteit van bewijs laag tot matig).
  • Behandeling met NSAID’s gaat gepaard met het optreden van onder andere gastro-intestinale en cardiovasculaire bijwerkingen (kwaliteit van bewijs varieert van hoog tot laag, afhankelijk van bijwerking en type NSAID, zie NHG-Standaard Pijn).
Samenvatting van bewijs: opiaten
Achtergrond

Opiaten zijn in het algemeen zeer effectieve analgetica. Er wordt onderscheid gemaakt tussen zwakwerkende opiaten (zoals tramadol) en sterkwerkende opiaten (zoals morfine, fentanyl en buprenorfine). Alle opiaten hebben een grote affiniteit voor de mu-receptoren. Deze receptoren zijn verantwoordelijk voor de analgetische effecten, maar ook voor belangrijke bijwerkingen, zoals ademhalingsdepressie, euforie, sedering en verslaving.

Op basis van drie cohortonderzoeken zijn er aanwijzingen dat behandeling met opiaten bij acute lagerugpijn gepaard gaat met een langere duur tot herstel en slechter functioneren op de lange termijn. 84 85 86

Uitgangsvraag

Zijn opiaten aan te bevelen aan patiënten met aspecifieke chronische lagerugpijn?

Cruciale uitkomstmaten

  • Ernst van de rugpijn
  • Functionaliteit
  • Mate van ervaren herstel
  • Bijwerkingen

Het systematisch literatuuronderzoek van Chaporro vormt de basis voor de beantwoording van deze uitgangsvraag. 87

Resultaten

Beschrijving onderzoeken

In het systematische literatuuronderzoek van Chaparro werden 15 RCT’s (n = 5540) geïncludeerd, waarin de effectiviteit van opiaten (zowel zwak- als sterkwerkende opiaten, verschillende toedieningsvormen) bij chronische lagerugpijn in een poliklinische/eerstelijnssetting werd onderzocht. Alleen RCT’s waarin de opiaten gedurende minstens een maand werden gebruikt, werden geïncludeerd. De follow-upduur werd niet beschreven bij de resultaten. De follow-upduur in de geïncludeerde onderzoeken varieerde van 4 tot 15 weken.

Kwaliteit van bewijs

De kwaliteit van bewijs in de review van Chaparro voor de verschillende uitkomstmaten varieert van zeer laag tot matig. De kwaliteit van bewijs wordt vooral verlaagd door het ontbreken van een adequate randomisatieprocedure en concealment of allocation, het niet blinderen van de beoordelaar van de uitkomstmaten en in alle onderzoeken stopte meer dan 20% van de patiënten vroegtijdig met de behandeling. Daarnaast was er bij een aantal vergelijkingen sprake van onnauwkeurigheid en inconsistentie.

Effectiviteit

  • Tramadol vs. placebo. In 5 RCT’s (n = 1378) werd tramadol met placebo vergeleken. Behandeling met tramadol leidde tot meer pijnverlichting dan placebo (kwaliteit van bewijs laag, SMD -0,55; 95%-BI -0,66 tot -0,44). Ook was er sprake van een, klinisch niet-relevante, verbetering van de functionaliteit ten gunste van tramadol (kwaliteit van bewijs matig, SMD -0,18; 95%-BI -0,2 tot -0,07).
  • Buprenorfine vs. placebo. In 2 RCT’s (n = 653) werd behandeling met transdermaal buprenorfine vergeleken met placebo. Transdermaal buprenorfine bleek effectiever in het verlichten van pijn dan placebo (kwaliteit van bewijs zeer laag, SMD -2,47; 95%-BI -2,69 tot -2,25). Er was geen verschil ten aanzien van de functionaliteit (kwaliteit van bewijs zeer laag).
  • Sterkwerkende opiaten vs. placebo. In 6 RCT’s (n = 1887) werd behandeling met sterkwerkende opiaten (morfine, hydromorphon, oxymofine, tapentadol, oxycodon) vergeleken met placebo. Sterkwerkende opiaten verlichtten de pijn effectiever dan placebo (kwaliteit van bewijs matig; SMD -0,43, 95%-BI -0,52 tot -0,33) en hadden een gunstiger effect op de functionaliteit dan placebo (kwaliteit van bewijs matig; SMD -0,26; 95%-BI -0,37 tot -0,15). Deze verschillen zijn niet klinisch relevant.
  • Opiaten vs. andere analgetica. Er is bewijs van zeer lage kwaliteit dat tramadol effectiever is dan celecoxib in het verminderen van pijn na 6 weken (1 RCT, n = 1583; RR 0,82; 95%-BI 0,76-0,90). Er is bewijs van zeer lage kwaliteit dat opiaten niet effectiever zijn dan de antidepressiva nortriptyline en flupirtine.

Bijwerkingen

Misselijkheid (verschil in incidentie tussen opiaten en placebo: 10%; 95%-BI 7 tot 14%), duizeligheid (8%; 95%-BI 5 tot 11%), obstipatie (7%; 95%-BI 4 tot 11%), braken (7%; 95%-BI 4 tot 9%); slaperigheid (6%; 95%-BI 3 tot 9%), droge mond (6%; 95%-BI 2 tot 10%) en hoofdpijn, jeuk, vermoeidheid, anorexie, transpireren en opvliegers (alle < 5%) werden significant vaker gerapporteerd ten tijde van behandeling met opiaten dan in de placebogroep.

Conclusie
  • Het is onduidelijk of er klinisch relevante verschillen zijn wat betreft pijn en functionaliteit tussen het gebruik van opiaten gedurende ten minste één maand en placebo bij patiënten met chronische aspecifieke lagerugpijn (klachtenduur > 12 weken) (kwaliteit van bewijs zeer laag tot matig).
  • Er worden meer bijwerkingen gerapporteerd ten tijde van de behandeling met zwak- en sterkwerkende opiaten ten opzichte van placebo.

Antidepressiva

Naar Samenvatting ›

Antidepressiva worden niet aanbevolen bij aspecifieke lagerugpijn.

Details
Van bewijs naar aanbeveling

Er is weinig onderzoek beschikbaar dat de effecten en bijwerkingen van antidepressiva vergelijkt met placebo bij patiënten met lagerugpijn. De kwaliteit van het beschikbare bewijs varieert van laag tot matig. De onderzoeken bij patiënten met chronische lagerugpijn laten geen klinisch relevante pijnvermindering bij gebruik van de verschillende groepen antidepressiva zien ten opzichte van placebo. Het effect van antidepressiva op de functionaliteit is in de onderzoeken niet beschreven, en de bijwerkingen zijn zeer summier beschreven. In onderzoek naar de effectiviteit van antidepressiva bij neuropathische pijn blijkt vooral behandeling met tricyclische antidepressiva frequent gepaard te gaan met bijwerkingen (zie NHG-Standaard Pijn). Bovendien is er bij aspecifieke lagerugpijn over het algemeen sprake van nociceptieve pijn. Daarom is de werkgroep van mening dat er geen plaats is voor antidepressiva bij de behandeling van aspecifieke lagerugpijn zonder depressie.

Samenvatting van bewijs
Achtergrond

Tricyclische antidepressiva (TCA’s) en de serotoninenoradrenalineheropnameremmers (SNRI’s) venlafaxine en duloxetine zijn effectief bij de behandeling van neuropathische pijn (zie NHG-Standaard Pijn). Aangezien het enkele weken duurt voordat het effect van antidepressiva te beoordelen is en aspecifieke lagerugpijn een gunstig natuurlijk beloop heeft, is behandeling met antidepressiva bij acute klachten niet aan de orde.

Het is onduidelijk of antidepressiva werkzaam zijn bij chronische aspecifieke lagerugpijn.

Uitgangsvraag

Zijn antidepressiva aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Bijwerkingen

Bij de beantwoording van deze uitgangsvraag is gebruikgemaakt van twee systematische literatuuronderzoeken: één waarin de effectiviteit en bijwerkingen van tricyclische antidepressiva en specifieke serotonineheropnameremmers (SSRI’s) ten opzichte van placebo werden beschreven 88 en één waarin de effectiviteit en bijwerkingen van duloxetine (een serotonine-noradrenalineheropnameremmer (SNRI)) ten opzichte van placebo werden beschreven. 89

Resultaten

Beschrijving onderzoeken

Het literatuuronderzoek van Kuijpers (4 RCT’s) evalueerde de effecten van TCA’s en/of SSRI’s bij patiënten met chronische lagerugpijn (klachtenduur > 12 weken). Twee hiervan onderzochten TCA’s, SSRI’s en placebo, de derde vergeleek een TCA met placebo en de vierde vergeleek een SNRI met placebo.

In het literatuuronderzoek van Cawston werden drie RCT’s (n = 982) opgenomen die het effect van duloxetine vergeleken met placebo bij patiënten met chronische lagerugpijn.

Kwaliteit van bewijs

De kwaliteit van het bewijs voor TCA’s en SSRI’s was laag tot zeer laag vanwege kans op vertekening en (ernstige) onnauwkeurigheid van de resultaten. De kwaliteit van het bewijs voor duloxetine was matig vanwege onnauwkeurigheid van de resultaten.

Effectiviteit

De enige uitkomstmaat die gepoold kon worden, was rugpijn, uitgedrukt als SMD.

  • TCA’s vs. placebo. De resultaten van twee RCT’s (n = 104) konden gepoold worden. De gebruikte TCA’s waren maprotiline en desipramine. Na 8 tot 12 weken was er geen verschil in pijnscore tussen de TCA-groepen en de placebogroepen (SMD -0,11; 95%-BI -0,72 tot 0,51).
  • SSRI’s vs. placebo. De resultaten van drie RCT’s (n = 199) konden gepoold worden. In twee onderzoeken werd paroxetine gebruikt, in het derde onderzoek werd fluoxetine gebruikt. Na 8 tot 12 weken was er geen verschil in pijnscore tussen de SSRI-groepen en de placebogroepen (SMD 0,11; 95%-BI -0,17 tot 0,39).

  • Duloxetine vs.placebo. Na 12 tot 13 weken was er geen klinisch relevant verschil in pijnscore tussen de duloxetinegroepen en de placebogroepen (SMD -0,24; 95%-BI -0,55 tot 0).

Bijwerkingen

Bijwerkingen werden zeer summier beschreven. Twee RCT’s waarin TCA’s (nortriptyline en maprotiline) en SSRI’s (paroxetine) werden vergeleken met placebo, konden gepoold worden en lieten geen verschil in optreden van bijwerkingen zien tussen interventie- en placebogroepen (RR 0,93; 95%-BI 0,84 tot 1,04). Bijwerkingen die frequent werden genoemd in beide groepen waren een droge mond, slapeloosheid, sedatie, orthostatische symptomen en obstipatie. In de meta-analyse over duloxetine werden geen bijwerkingen beschreven.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is onduidelijk of er klinisch relevante verschillen bestaan tussen antidepressiva en placebo voor de behandeling van chronische lagerugpijn (kwaliteit van bewijs varieert van zeer laag tot matig).

Anti-epileptica

Naar Samenvatting ›

Anti-epileptica  worden niet aanbevolen bij aspecifieke lagerugpijn.

Details
Van bewijs naar aanbeveling

Er is weinig goed onderzoek beschikbaar dat anti-epileptica vergelijkt met placebo bij patiënten met lagerugpijn: één onderzoek bij patiënten met chronische lagerugpijn (waarvan een deel met radiculopathie) en geen onderzoek bij patiënten met acute lagerugpijn. De kwaliteit van het beschikbare bewijs is laag. Gebruik van topiramaat of andere anti-epileptica kan wel tot bijwerkingen leiden (zie NHG-Standaard Pijn). Bovendien is er bij aspecifieke lagerugpijn over het algemeen sprake van nociceptieve pijn. Daarom is de werkgroep van mening dat er geen plaats is voor anti-epileptica bij de behandeling van aspecifieke lagerugpijn.

Samenvatting bewijs
Achtergrond

Anti-epileptica (bijvoorbeeld gabapentine, pregabaline) zijn werkzaam bij neuropathische pijn. Aangezien het enkele weken duurt voordat het effect van anti-epileptica te beoordelen is en aspecifieke lagerugpijn een gunstig natuurlijk beloop heeft, is behandeling met anti-epileptica bij acute klachten niet aan de orde. Het is onduidelijk of deze medicatie werkzaam is bij chronische aspecifieke lagerugpijn.

Uitgangsvraag

Zijn anti-epileptica aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Bijwerkingen

Bij de beantwoording van deze uitgangsvraag heeft het NHG een literatuursearch uitgevoerd in juli 2015. Hieruit kwamen twee systematische literatuuronderzoeken naar voren. 90 91 Beide onderzoeken vonden één RCT, waarin topiramaat met placebo werd vergeleken. 92

Resultaten

Beschrijving onderzoek

De RCT includeerde 96 patiënten met chronische lagerugpijn (minimaal 6 maanden bestaand), met of zonder pijn in het been, gerandomiseerd naar topiramaat of placebo. De patiënten werden tien weken gevolgd. Uitkomstmaten die onderzocht werden, waren onder andere pijn (Pain Rating Index van de McGill Pain Questionnaire (MPQ), schaal 0-78), functionaliteit (Oswestry Low Back Pain Disability Questionnaire (ODI), schaal 0-100%) en gezondheidsgerelateerde kwaliteit van leven (SF-36).

Kwaliteit van bewijs

De kwaliteit van het bewijs was laag vanwege indirect bewijs (zowel patiënten met als zonder radiculopathie werden ingesloten; daarnaast is het geneesmiddel dat onderzocht is, topiramaat, in Nederland niet gebruikelijk voor de behandeling van neuropathische pijn) en onnauwkeurigheid van de resultaten.

Effectiviteit

  • Topiramaat vs. placebo. Na tien weken was de MPQ-pijnscore in de topiramaatgroep 11,4 punten meer gedaald dan in de placebogroep (95%-BI -13,1 tot -11,1) Dit verschil is beperkt klinisch relevant. De ODI-score was 4,8 punten meer gedaald in de topiramaatgroep dan in de placebogroep (95%-BI -5,6 tot -4,0).

Bijwerkingen

Gedurende het onderzoek traden er geen ernstige bijwerkingen op. Bijwerkingen die voorkwamen, waren slaperigheid, visusproblemen, traagheid, geheugenproblemen, duizeligheid, hoofdpijn, paresthesieën en/of tremor. De aantallen patiënten met deze bijwerkingen waren echter te laag om hier verschillen tussen de groepen te kunnen aantonen.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is onduidelijk of er klinisch relevante verschillen bestaan tussen topiramaat en placebo voor de behandeling van (chronische) lagerugpijn (algehele kwaliteit van bewijs laag).

Benzodiazepinen

Naar Samenvatting ›

Benzodiazepinen worden niet aanbevolen bij aspecifieke lagerugpijn.

Details
Van bewijs naar aanbeveling

Onderzoek naar orale benzodiazepinen in de behandeling van acute lagerugklachten is niet voorhanden. Er is weinig goed onderzoek beschikbaar dat orale benzodiazepinen vergelijkt met placebo bij patiënten met chronische lagerugpijn. De kwaliteit van het beschikbare bewijs is bovendien zeer laag. De twee onderzoeken bij patiënten met chronisch lagerugpijn laten geen klinisch relevante pijnvermindering van tetrazepam zien ten opzichte van placebo; functionaliteit of bijwerkingen zijn in het onderzoek niet beschreven. Tetrazepam is in 2013 van de Europese markt gehaald vanwege bijwerkingen (ernstige huidreacties); de overige wel in Nederland geregistreerde benzodiazepines geven ook een reële kans op bijwerkingen (onder andere een negatieve invloed op alertheid, concentratievermogen en motorische vaardigheid en het risico op afhankelijkheid, rebound- en andere onttrekkingssyndromen). 93 Het weinige onderzoek naar injecties met benzodiazepinen bij acute lagerugklachten laat tegenstrijdige resultaten zien. Daarom is de werkgroep van mening dat er geen plaats is voor benzodiazepinen bij de behandeling van (acute of chronische) lagerugpijn.

Samenvatting van bewijs
Achtergrond

Achtergrond

Het voorschrijven van benzodiazepinen is bij aspecifieke lagerugpijn in de huisartsenpraktijk niet ongewoon, hoewel de meeste (inter)nationale richtlijnen, waaronder de vorige versie van de NHG-Standaard, dit niet aanbevelen. Uit een vragenlijstonderzoek in de Verenigde Staten bleek 91% van 182 huisartsen ten minste incidenteel een dergelijk middel bij deze aandoening voor te schrijven. 94 Een vragenlijstonderzoek onder 46 huisartsen uit de regio Nijmegen toonde hetzelfde aan. 95 Hier betrof het in vrijwel alle gevallen een benzodiazepine, meestal diazepam, in een gemiddelde dosering van tweemaal daags 6 mg gedurende 7 dagen. In driekwart van de gevallen beoogde de huisarts spierontspanning, in ruim de helft (ook) sedatie.

Uitgangsvraag

Zijn benzodiazepinen aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Bijwerkingen

Bij de beantwoording van deze uitgangsvraag is gebruikgemaakt van een Cochrane-review van Van Tulder. 96

Resultaten

Beschrijving onderzoeken

In de Cochrane-review van Van Tulder 96 werden dertig onderzoeken geïncludeerd die de effecten van spierverslappers bij patiënten met acute of chronische lagerugpijn evalueerden. Drie RCT’s vergeleken orale benzodiazepinen met placebo, alle bij patiënten met chronische lagerugpijn, waarbij niet is gedefinieerd wat de klachtenduur was. Twee daarvan (n = 152) hadden pijn als uitkomstmaat en konden gepoold worden. In deze onderzoeken werd driemaal daags 50 mg tetrazepam (equivalent aan driemaal daags 5 mg diazepam) vergeleken met driemaal daags placebo, gedurende 10 of 14 dagen.

Twee RCT’s vergeleken benzodiazepine-injecties met placebo-injecties bij patiënten met acute lagerugpijn. Eén RCT (n = 50) vergeleek intramusculaire injecties met 10 mg diazepam elke 6 uur gedurende 24 uur, gevolgd door viermaal daags 2 mg orale diazepam plus tweemaal daags 10 mg calciumaspirine gedurende 5 dagen, met intramusculaire placebo-injecties elke 6 uur gedurende 24 uur, gevolgd door viermaal daags placebotabletten plus tweemaal daags 10 mg calciumaspirine gedurende 5 dagen. De andere RCT (n = 68) vergeleek een intramusculaire injectie met 10 mg diazepam, gevolgd door tweemaal daags 2 diazepamtabletten (dosering onbekend) gedurende 5 tot 10 dagen, met een intramusculaire placebo-injectie gevolgd door tweemaal daags 2 placebotabletten gedurende 5 tot 10 dagen.

Kwaliteit van bewijs

De kwaliteit van het bewijs voor orale benzodiazepinen was zeer laag vanwege kans op vertekening, indirect bewijs (het middel dat onderzocht werd was tetrazepam. Dit is in Nederland sinds 2013 niet meer op de markt in verband met bijwerkingen) en onnauwkeurigheid. Bovendien waren beide onderzoeken gesponsord door de farmaceutische industrie.

De kwaliteit van het bewijs voor benzodiazepine-injecties was zeer laag vanwege kans op vertekening, inconsistentie en onnauwkeurigheid.

Effectiviteit

  • Orale benzodiazepinen vs. placebo. De enige uitkomstmaat die gepoold kon worden, was pijn als dichotome uitkomstmaat. Er is niet beschreven hoe dit bepaald is. Na 5-7 dagen ondervond 75% van de patiënten in de tetrazepamgroepen pijnklachten en 93% van de patiënten in de placebogroepen (RR 0,82; 95%-BI 0,72 tot 0,94). Na 8-14 dagen was dit gedaald tot resp. 48 en 70% (RR 0,71; 95%- BI 0,54 tot 0,93).
  • Intramusculaire benzodiazepinen vs. placebo. Vanwege heterogeniteit werden de onderzoeken niet gepoold. Het ene onderzoek vond aan het eind van de behandelperiode geen verschillen in pijn, gevoeligheid en objectieve maten bij lichamelijk onderzoek. Het andere onderzoek keek naar het therapeutische effect aan het eind van de behandelperiode, uitgedrukt als 0 = geen; 1 = matig; 2 = goed; 3 = zeer goed. De gemiddelde score in de interventiegroep was 1,8 (SD 1,2) en in de placebogroep 0,3 (SD 0,8), wat een significant verschil was.

Bijwerkingen

Bijwerkingen werden niet onderzocht in de geïncludeerde onderzoeken. In het onderzoek van Moll et al., dat ook in de Cochrane-review was opgenomen, werd melding gemaakt dat het gebruik van benzodiazepinen gepaard ging met meer bijwerkingen van het centrale zenuwstelsel. Dit werd niet nader gespecificeerd.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is zeer onduidelijk of er klinisch relevante verschillen bestaan tussen benzodiazepinen en placebo voor de behandeling van (chronische) lagerugpijn (algehele kwaliteit van bewijs zeer laag).

Injecties

Naar Samenvatting ›

Injecties met analgetica of corticosteroïden (bijvoorbeeld ter plaatse van de facetgewrichten of epiduraal) worden niet aanbevolen bij aspecifieke lagerugpijn.

Details
Van bewijs naar aanbeveling

Er is geen onderzoek beschikbaar naar invasieve pijnbestrijding bij acute lagerugpijn. De werkgroep is van mening dat er, gezien de grote kans op het spontaan verdwijnen van de klachten bij deze groep patiënten, geen plaats is voor invasieve pijnbestrijding.

Er is weinig onderzoek beschikbaar naar invasieve pijnbestrijding bij chronische aspecifieke lagerugpijn. Bovendien is de kwaliteit van het beschikbare bewijs laag tot zeer laag en worden in de verschillende onderzoeken zeer diverse interventies met elkaar vergeleken, waardoor er geen eenduidige conclusie te trekken is. Ten slotte zijn eventuele bijwerkingen van invasieve pijnbestrijding onvoldoende onderzocht. De werkgroep is derhalve van mening dat er op dit moment geen plaats is voor invasieve pijnbestrijding met injecties bij de behandeling van chronische aspecifieke lagerugpijn.

Samenvatting van bewijs
Achtergrond

Toegepaste methodes voor invasieve pijnbestrijding bij lagerugpijn zijn lokale injecties met analgetica en/of corticosteroïden, bijvoorbeeld epiduraal of ter plaatse van de facetgewrichten. Het is onduidelijk of deze injecties werkzaam zijn.

Uitgangsvraag

Zijn injecties met analgetica en/of corticosteroïden, epiduraal, ter plaatse van de facetgewrichten of ter plaatse van het sacro-iliacale gewricht, aan te bevelen bij patiënten met aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Bijwerkingen

Bij de beantwoording van deze uitgangsvraag is gebruikgemaakt van een systematisch literatuuronderzoek. 97 In dit systematische literatuuronderzoek is een search uitgevoerd tot oktober 2014.

Resultaten

Beschrijving onderzoeken

In de review van Chou werden 92 RCT’s geïncludeerd die de effecten en bijwerkingen van corticosteroïdinjecties (epiduraal of ter plaatse van de facetgewrichten of het sacro-iliacale gewricht) vergeleken met placebo of andere interventies bij patiënten met lumbosacrale radiculopathie, wervelkanaalstenose, niet-radiculaire rugpijn of postchirurgische rugpijn. Voor zover de duur van de symptomen was gemeld, ging het om rugpijn die minimaal drie maanden tot enkele jaren bestond. In deze noot hebben wij ons gericht op de patiëntengroepen met niet-radiculaire rugpijn. Er werden voor deze indicatie in totaal 16 RCT’s geïncludeerd voor 3 niveaus van injectie.

  • Epidurale injecties. Er waren 2 RCT’s (n = 240) waarin een injectie met corticosteroïden (betamethason of methylprednisolon) en lidocaïne werd vergeleken met een injectie met alleen lidocaïne. De follow-up was 2 jaar.
  • Injecties ter plaatse van de facetgewrichten. Er waren 13 RCT’s (n = 976). Deze waren zeer heterogeen ten aanzien van de plaats van injectie (intra-articulair, extra-articulair), toegevoegde analgetica (lidocaïne, bupivacaïne, lignocaïne, Sarapin), toegepaste controlebehandelingen (injectieplaats, geneesmiddel of fysiologisch zout), follow-up (variërend van 1 tot 24 maanden) en gerapporteerde uitkomsten.
  • Injecties ter plaatse van het sacro-iliacale gewricht. Er was 1 RCT (n = 24) waarin een peri-articulaire injectie met methylprednisolon en lidocaïne werd vergeleken met een peri-articulaire injectie met alleen lidocaïne. De follow-up was 1 maand.

Kwaliteit van bewijs

  • Epidurale injecties. De kwaliteit van het bewijs was laag. Er werd afgewaardeerd vanwege kans op vertekening en onnauwkeurigheid.
  • Injecties ter plaatse van de facetgewrichten. De kwaliteit van het bewijs was laag tot zeer laag. Er werd afgewaardeerd vanwege kans op vertekening, inconsistentie en onnauwkeurigheid van de resultaten.
  • Injecties ter plaatse van het sacro-iliacale gewricht. De kwaliteit van het bewijs was zeer laag. Er werd afgewaardeerd vanwege kans op vertekening en zeer ernstige onnauwkeurigheid.

Effectiviteit

Epidurale injecties

  • In de 2 RCT’s werd geen verschil gevonden tussen epidurale corticosteroïdinjecties en epidurale injecties met analgetica wat betreft pijn, functionaliteit of gebruik van opiaten.

Injecties ter plaatse van de facetgewrichten
De onderzoeken waren dermate heterogeen dat de resultaten niet gepoold konden worden.

  • Twee RCT’s die intra-articulaire corticosteroïdinjecties, al dan niet gecombineerd met analgetica, vergeleken met intra-articulaire injecties met fysiologisch zout en 1 RCT die deze vergeleken met intra-articulaire injecties met hyaluronzuur, lieten geen klinisch relevante verschillen zien in pijn en functionaliteit.
  • Een RCT waarin intra-articulaire injecties met corticosteroïden en analgetica werden vergeleken met intramusculaire injecties met dezelfde geneesmiddelen, toonde geen verschillen aan.
  • Twee RCT’s waarin intra-articulaire injecties met corticosteroïden en analgetica werden vergeleken met een blokkade van de mediale tak van de ramus dorsalis met dezelfde geneesmiddelen, lieten een klein verschil zien in pijnafname ten gunste van intra-articulaire injecties; onduidelijk is of dit verschil klinisch relevant is. In een derde vergelijkbare RCT, waarin voor de blokkade echter alleen een analgeticum werd gebruikt, werden geen verschillen gevonden in pijn en functionaliteit.
  • Een RCT vond dat een blokkade van de mediale tak van de ramus dorsalis met corticosteroïden en analgetica inferieur was aan radiofrequente facetdenervatie wat betreft pijn na 1, 6 en 12 maanden, terwijl een andere RCT geen verschillen in pijn en functionaliteit vond tussen intra-articulaire injecties met corticosteroïden en analgetica enerzijds en radiofrequente neurotomie van de mediale tak van de ramus dorsalis met lokale injectie van een analgeticum anderzijds.

Injecties ter plaatse van het sacro-iliacale gewricht.
Na één maand was de pijn significant meer afgenomen in de methylprednisolon/lidocaïnegroep dan in de lidocaïnegroep. Omdat er alleen een p-waarde werd gerapporteerd, is niet goed te zeggen of dit verschil ook klinisch relevant is.

Bijwerkingen

In de RCT’s werden geen ernstige bijwerkingen gerapporteerd, maar de manier waarop gegevens over bijwerkingen werden verzameld was niet goed gerapporteerd en veel RCT’s rapporteerden bijwerkingen in het geheel niet. Niet-ernstige bijwerkingen die werden genoemd waren hoofdpijn, duizeligheid, hyperglykemie, voorbijgaande hypertensie, voorbijgaande lokale pijn, tintelend of doof gevoel en misselijkheid.

Gegevens uit grote, observationele onderzoeken lieten zien dat ernstige bijwerkingen van injectietherapie zelden voorkwamen, maar dat minder ernstige bijwerkingen vaker voorkwamen, zoals lokaal hematoom, bloeding en duraperforatie (met potentiële liquorlekkage). Ook voorbijgaande zenuwwortelprikkeling kwam voor bij 0 tot 5% van de patiënten, afhankelijk van de methode en plaats van injectie.

In een oudere Cochrane-review werd erop gewezen dat in de literatuur ook incidenteel ernstige bijwerkingen werden gemeld, zoals cauda-equinasyndroom, septische artritis en paraspinale abcessen. 98 Er werden geen percentages beschreven.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is (zeer) onduidelijk of er klinisch relevante verschillen bestaan tussen lokale injecties met corticosteroïden en placebo-injecties, of tussen verschillende soorten injecties voor de behandeling van chronische aspecifieke lagerugpijn (algehele kwaliteit van bewijs laag tot zeer laag). Er zijn geen gegevens beschikbaar over deze behandelingen voor acute lagerugpijn.

Overige behandelingen

Naar Samenvatting ›

Radiofrequente laesie

Naar Samenvatting ›

Radiofrequente laesie wordt niet aanbevolen bij aspecifieke lagerugpijn.

Details
Van bewijs naar aanbeveling

Er is geen onderzoek beschikbaar naar invasieve pijnbestrijding door middel van RF laesie bij acute lagerugpijn. De werkgroep is van mening dat er, gezien de grote kans op het spontaan verdwijnen van de klachten bij deze groep patiënten, geen plaats is voor invasieve pijnbestrijding.

Er is weinig onderzoek beschikbaar naar RF laesie bij chronische aspecifieke lagerugpijn. Bovendien is de algehele kwaliteit van het beschikbare bewijs zeer laag, waardoor de resultaten onzeker zijn. Ten slotte zijn eventuele complicaties van RF laesie onvoldoende onderzocht. De werkgroep is daarom van mening dat er op dit moment geen plaats is voor invasieve pijnbestrijding door middel van RF laesie bij de behandeling van chronische aspecifieke lagerugpijn.

Samenvatting van bewijs
Achtergrond

Zenuwblokkade door middel van een radiofrequente (RF) laesie is een vorm van invasieve pijnbestrijding waarbij door hittebehandeling de sensorische zenuw wordt gecoaguleerd, waardoor de transmissie van nociceptieve signalen wordt onderbroken. Het is onduidelijk of RF laesie effectief is bij chronische aspecifieke lagerugpijn.

Uitgangsvraag

Is RF laesie aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Complicaties

Bij de beantwoording van deze uitgangsvraag werd uitgegaan van een Cochrane-review waarin de effecten van RF laesie in vergelijking met geen RF laesie werden onderzocht bij patiënten met chronische lagerugpijn. 99

Resultaten

Beschrijving onderzoeken

In de Cochrane-review werden 23 RCT’s (n = 1309) geïncludeerd waarin RF laesie bij chronische aspecifieke lagerugpijn werd onderzocht. De gemiddelde leeftijd van de deelnemers was ongeveer 50 jaar. 12 RCT’s onderzochten veronderstelde facetgewrichtspijn, 5 RCT’s discogene pijn, 2 RCT’s SI-gewrichtspijn, 2 RCT’s radiculaire chronische lagerugpijn, 1 RCT uitstralende lagerugpijn en 1 RCT chronische lagerugpijn met of zonder uitstraling. Wij hebben ons beperkt tot facetgewrichtspijn, discogene pijn en SI-gewrichtspijn.

  • Facetgewrichtspijn. In de RCT’s werden patiënten geïncludeerd met een minimum klachtenduur van 3 tot 12 maanden en een positieve respons op lokale injecties met anaesthetica (proefblokkade). 6 RCT’s (n = 323) vergeleken RF laesie met placebo (hierbij werden wel elektrodes geplaatst, maar geen RF laesie geïnduceerd), 3 RCT’s (n = 276) vergeleken RF laesie met corticosteroïdinjecties.
  • Discogene pijn. In de RCT’s werden patiënten geïncludeerd met een klachtenduur variërend van 6 maanden tot langer dan twee jaar en een positieve respons op discografie. 4 RCT’s (n = 161) waren placebogecontroleerd; in 3 hiervan werd intradiscale RF thermocoagulatie toegepast, in de vierde vond RF denervatie van de ramus communicans plaats (buiten de discus).
  • SI-gewrichtspijn. In beide RCT’s (n = 79) werden patiënten met een klachtenduur van minimaal 6 maanden geïncludeerd, allen met een positieve respons op een diagnostische injectie. Beide RCT’s waren placebo-gecontroleerd.

Kwaliteit van bewijs

De kwaliteit van het bewijs varieerde van matig tot zeer laag. Er werd afgewaardeerd vanwege kans op vertekening, inconsistentie en onnauwkeurigheid van de resultaten.

Effectiviteit

  • Facetgewrichtspijn; RF laesie vs. placebo. Een maand na RF laesie was de pijnscore afgenomen met 1,5 punt (95%-BI -2,3 tot -0,7) op een VAS van 10 punten. Dit verschil was echter niet klinisch relevant en verdween na langere follow-uptijd (1 tot 6 maanden: -0,7 (95%-BI -2,3 tot 0,8); > 6 maanden: -0,7 (95%-BI -1,5 tot 0,1)). De disfunctiescore nam ook af, maar eveneens met een niet-klinisch relevant verschil (ODI-score van 100 punten, na 1 maand: -5,5 (95%-BI -8,7 tot -2,4); na > 6 maanden: -3,7 (95%-BI -6,9 tot -0,5)).
  • Facetgewrichtspijn; RF laesie vs. corticosteroïdinjectie. Na 1, 6 en 12 maanden was er een klinisch relevante verbetering van de pijnscore na RF laesie vergeleken met corticosteroïdinjectie (VAS 10 punten, gemiddeld verschil na 1 maand -2,2 (95%-BI -2,4 tot -2,1); na 6 maanden -2,1 (95%-BI -3,5 tot -0,8); na 12 maanden -2,7 (95%-BI -3,4 tot -1,9)). Functionaliteit werd in 1 RCT onderzocht. De ODI-score verschilde niet tussen de RF laesiegroep en de corticosteroïdinjectiegroep (gemiddeld verschil na 1-6 maanden -5,0 (95%-BI -15,2 tot 5,2).
  • Discogene pijn. RF laesie vs. placebo. Tot 6 maanden na de behandeling was er geen verschil in pijn en functionaliteit. Na > 6 maanden was de pijn meer afgenomen en de functionaliteit meer verbeterd in de RF laesiegroep dan in de placebogroep, maar dit verschil was niet klinisch relevant (pijn: VAS-schaal van 10 punten: -0.8 (95%-BI -1,2 tot -0,3); disfunctie: ODI-score van 100 punten: -6,8 (95%-BI -13,4 tot -0,1)).
  • SI-gewrichtspijn. RF laesie vs. placebo. Tot 6 maanden na de behandeling was er geen klinisch relevant verschil in pijn en functionaliteit tussen de RF laesiegroepen en de placebogroepen (1 tot 6 maanden: pijn: VAS-schaal van 10 punten: -1,3 (95%-BI -2,1 tot -0,5); disfunctie: ODI-score van 100 punten: -11,0 (95%-BI -17,9 tot -4,1)). Gegevens over een langere termijn zijn niet beschikbaar.

Complicaties/bijwerkingen

In tien RCT’s werden complicaties niet gerapporteerd. Twee RCT’s rapporteerden pijn geassocieerd met de procedure, één RCT rapporteerde klachten van lichte zwakte van de onderste extremiteit, één RCT rapporteerde niet-pijnlijke paresthesieën. Deze symptomen kwamen vaker voor en duurden langer in de RF laesiegroepen dan in de controlegroepen, maar waren geen van alle permanent. Meer gegevens hierover werden niet vermeld. In één RCT ervoeren twee actief behandelde en drie met placebo behandelde patiënten toegenomen pijn, waardoor werd afgezien van verdere inclusie van deelnemers. Drie RCT’s rapporteerden complicaties (verandering in pijnkarakteristieken, exacerbatie van pijn, kleine oppervlakkige brandwonden na RF laesie) die niet langer dan een maand duurden.

De meeste RCT’s waren klein en niet opgezet om complicaties of bijwerkingen te evalueren, waardoor het niet mogelijk is om verschillen tussen de verschillende groepen aan te tonen.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is zeer onduidelijk of er klinisch relevante verschillen bestaan wat betreft pijn, functionaliteit in complicaties tussen RF laesie en placebobehandeling of corticosteroïdinjecties bij patiënten met chronische lagerugpijn (algehele kwaliteit van bewijs zeer laag).

Operatieve behandeling

Naar Samenvatting ›

Operatieve behandelingen worden niet aanbevolen bij patiënten met aspecifieke lagerugpijn.

Details
Van bewijs naar aanbeveling

De kwaliteit van het bewijs naar operaties bij lagerugpijn is laag. De onderzoeken bij patiënten met chronische lagerugpijn laten geen klinisch relevante verbetering van pijn of functionaliteit zien na operatieve behandeling, ten opzichte van conservatieve behandeling.

Een operatie kan tot (ernstige) complicaties leiden en er is onvoldoende bekend over langetermijneffecten. Zo wordt in observationele onderzoeken onder andere melding gemaakt van osteolyse, migratie van de kunstdiscus en polyethyleenslijtage jaren na plaatsing van een kunstdiscus. 100 101 102 Daarom is de werkgroep van mening dat er geen plaats is voor operatie bij de behandeling van aspecifieke lagerugpijn.

Samenvatting van bewijs
Achtergrond

Bij lagerugpijn toegepaste operatieve ingrepen zijn onder meer lumbale fusie (spondylodese) en het inbrengen van een discusprothese. Deze ingrepen worden toegepast bij patiënten met degeneratie van de discus intervertebralis, waarvan verondersteld wordt dat dit de oorzaak is van de rugpijn. Bij lumbale fusie worden twee of meerdere wervels aan elkaar vastgezet middels osteosynthesemateriaal, aangevuld met bot of met bot alleen. In geval van een lumbale discusprothese vindt discectomie plaats, waarna met het plaatsen van een discusprothese de hoogte van het wervelsegment hersteld wordt en beweging behouden kan worden.

Uitgangsvraag

Is operatief ingrijpen (zoals lumbale fusie of het inbrengen van een discusprothese) aan te bevelen bij patiënten met chronische aspecifieke lagerugpijn?

Cruciale uitkomstmaten

  • Rugpijn
  • Functionaliteit/mate van beperking
  • Tijdsduur tot herstel
  • Complicaties

Er is één systematisch literatuuronderzoek gevonden dat het inbrengen van een discusprothese vergeleek met conservatieve behandeling. 103 Omdat in dit literatuuronderzoek slechts één RCT werd ingesloten, is de originele RCT gebruikt voor de beantwoording van dit onderdeel van de uitgangsvraag. 104

Voor de beantwoording van het deel van de uitgangsvraag over lumbale fusie is uitgegaan van een systematisch literatuuronderzoek waarin de effecten van lumbale fusie werden vergeleken met conservatieve behandeling. 105 Voor beschrijving van complicaties van lumbale fusie is gebruikgemaakt van een systematisch literatuuronderzoek van Wang et al.. 106

Er werden geen RCT’s naar andere operatieve ingrepen bij aspecifieke lagerugpijn gevonden. Een aanvullende literatuursearch door het NHG in september 2015 leverde geen nieuwe RCT’s op.

Resultaten

Beschrijving onderzoeken

  • Discusprothese. In de RCT (n = 173) van Hellum et al. werd discusvervanging vergeleken met een revalidatieprogramma gedurende twee jaar bij patiënten met chronische lagerugpijn (klachtenduur minimaal een jaar) en degeneratieve veranderingen in de intervertrebrale discus in L4/L5 en/of L5/S1. 104 De primaire uitkomstmaat was de score op de Oswestry Disability Index (ODI, 0-100, waarbij een hogere score ernstiger pijn en beperking weergeeft) na twee jaar. Secundaire uitkomstmaten waren onder andere pijn (VAS-score 0-100) en werkstatus (netto ‘back to work rate’, waarbij patiënten die weer zijn begonnen met werken worden afgetrokken van patiënten die zijn gestopt met werken).
  • Lumbale fusie. In het literatuuronderzoek van Phillips werden 6 RCT’s (n = 919) geïncludeerd die lumbale fusie vergeleken met niet-operatieve behandeling (bijvoorbeeld fysiotherapie, oefeningen of cognitieve interventies) bij patiënten met chronische lagerugpijn (klachtenduur minimaal 3 maanden) en een follow-upduur van ten minste 12 maanden. Uitkomstmaten die onderzocht werden zijn pijn (NRS of VAS), rugspecifieke functionaliteit (ODI), gezondheidsstatus (SF-36) en patiënttevredenheid.

Kwaliteit van bewijs

  • Discusprothese. De kwaliteit van het bewijs was laag vanwege kans op vertekening en onnauwkeurige resultaten.
  • Lumbale fusie. De kwaliteit van het bewijs was laag vanwege zeer ernstige heterogeniteit.

Effectiviteit

  • Discusprothese vs. revalidatieprogramma. Na één en na twee jaar waren pijn en functionaliteit in de operatiegroepen meer afgenomen dan in de revalidatiegroepen, maar dit verschil was niet klinisch relevant. Er was geen verschil in werkstatus tussen beide groepen.
  • Lumbale fusie vs. niet-operatieve behandeling. De uitkomstmaten pijn en functie waren zeer heterogeen. Daarom konden deze uitkomstmaten niet gepoold worden. In de verschillende onderzoeken liep het verschil in afname van ODI-score voor functioneren tussen lumbale fusie en conservatieve behandeling uiteen van 25,7 punten in het voordeel van lumbale fusie tot 3,7 punten in het voordeel van conservatieve behandeling; voor de VAS-score voor pijn liep dit verschil uiteen van 48 punten in het voordeel van lumbale fusie tot 1,3 punten in het voordeel van conservatieve behandeling.

Complicaties

Discusprothese. Van de in totaal 77 geopereerde patiënten traden er bij 26 patiënten (34%) diverse complicaties op, bijvoorbeeld ernstig bloedverlies tijdens de operatie, arteriële trombose, abdominale hernia, oppervlakkige bloeding, retrograde ejaculatie, ileus, tijdelijk warme linkervoet. Zes patiënten hadden complicaties die leidden tot een blijvende handicap na 2 jaar follow-up. Bij 5 patiënten (6,5%) was een tweede operatie nodig. Eén patiënt had een ernstige complicatie na loslating van de kunstdiscus, resulterend in amputatie van het onderbeen.

Lumbale fusie. Bij 18% van de patiënten werden complicaties gezien, zoals infectie, trombose, zenuwaanraking door de schroeven van de fixateur en peri-operatieve bloeding.

Zie voor het GRADE evidenceprofiel het deel Totstandkoming en methoden bij de webversie van deze standaard op www.nhg.org.

Conclusie

Het is onduidelijk of er klinisch relevante verschillen bestaan tussen operatieve behandeling (het plaatsen van een discusprothese of lumbale fusie) en conservatieve behandeling bij patiënten met (chronische) lagerugpijn (algehele kwaliteit van bewijs laag).

Controle

Naar Samenvatting ›

De frequentie van de controles hangt af van de ernst van de klachten, de verwachte noodzaak tot evaluatie en bijstelling van de ingestelde behandeling en de behoefte van de patiënt. Een leidraad voor de frequentie van de controles is:

  • bij een sterke toename van de pijn en/of beperkingen: na een tot twee dagen;
  • bij aanhoudende hevige pijn: na één week;
  • bij de start van een nieuwe behandeling (stappenplan): na twee tot drie weken;
  • bij het niet of niet meer verbeteren van het functioneren: na drie weken.

Aandachtspunten bij de controle:

  • beloop: 
    • vervolg het beloop aan de hand van de pijn (eventueel met behulp van een pijnschaal) en de mate van (dis)functioneren
    • indien de klachten niet verbeteren: herhaal anamnese en lichamelijk onderzoek. Inventariseer herstelbelemmerende factoren in de omstandigheden of het gedrag van de patiënt, eventueel met behulp van SCEGS (zie NHG-Standaard Pijn en NHG-Standaard SOLK)
    • blijf alert op een lumbosacraal radiculair syndroom of aanwijzingen voor een specifieke oorzaak van de klachten, vooral bij aanwezigheid van kenmerken zoals beschreven in tabel 1 en bij een onverklaarbaar langdurig of progressief beloop
  • herstelbelemmerende factoren: 
    • ga bij een klachtenduur van 3 tot 4 weken na of er psychosociale risicofactoren voor een chronisch beloop zijn (zie Anamnese)
  • pijnbestrijding: 
    • vraag naar de effectiviteit van eventuele medicatie, bijwerkingen en de invloed van medicatie op het dagelijks functioneren
    • pas zo nodig de medicatie aan
  • arbeidssituatie: vraag, indien van toepassing, naar:
    • arbeidsverzuim
    • contacten met de bedrijfsarts
    • eventuele belemmerende factoren voor werkhervatting

Consultatie/verwijzing

Naar Samenvatting ›

Bij vermoeden van een specifieke oorzaak van de rugpijn:

  • verwijs binnen 1 week naar een internist-oncoloog of orthopedisch chirurg:
    • patiënten met in de voorgeschiedenis een maligniteit en (een niet-bekende en onbegrepen) rugpijn
    • bij vermoeden van een metastase zonder bekende maligniteit
  • verwijs naar een reumatoloog:
    • bij vermoeden van axiale spondyloartritis
  • verwijs naar een orthopedisch chirurg:
    • bij vermoeden van een andere specifieke oorzaak van de rugpijn

Overleg bij twijfel over de indicatie of urgentie voor verwijzing met de desbetreffende specialist.
Bij aspecifieke lagerugpijn:

  • verwijs naar een fysio- of oefentherapeut, gedragsmatig therapeut of een centrum voor multidisciplinaire revalidatie aan de hand van het stappenplan (zie Niet-medicamenteuze behandeling)
  • verwijs zo nodig naar de bedrijfsarts, of neem zelf contact op met de bedrijfsarts (indien de patiënt daar toestemming voor geeft) indien:
    • er langdurige uitval is of wordt verwacht
    • er belemmeringen zijn voor de uitvoering van het werk vanwege de klachten
    • de patiënt van mening is dat de klachten (mede) zijn ontstaan of in stand worden gehouden door het werk
    • er behoefte is aan aanpassing van de werkplek
    • er behoefte is aan bedrijfsartsgeneeskundige expertise om op het werk (de gevolgen van) de klachten te duiden

Verwijs bij aspecifieke lagerugpijn bij voorkeur niet naar een monodisciplinair werkzame specialist.

Organisatie van de zorg

Naar Samenvatting ›

Zorg bij patiënten met chronische aspecifieke lagerugpijn voor afstemming van de zorg tussen de verschillende behandelaren, om te voorkomen dat verschillende behandelingen naast elkaar plaatsvinden of patiënten langdurig uitvallen uit het arbeidsproces. Maak daarom lokaal of regionaal afspraken met de disciplines die betrokken zijn bij lagerugpijn, zoals bedrijfsarts en fysio- of oefentherapeut, over:

  • wie bij verwijzing binnen de 1e lijn of naar de 2e lijn de behandeling coördineert en aanspreekpunt is voor patiënten en betrokken zorgverleners; bepalend hiervoor zijn de beschikbaarheid en de benodigde deskundigheid

Andere punten waarover lokaal of regionaal afspraken gemaakt kunnen worden (zie Samenwerkingsafspraken):

  • diagnostiek en behandeling
  • werkhervatting
  • samenwerking en communicatie, bijvoorbeeld over:
    • verwijzen en terugverwijzen
    • onderlinge uitwisseling van informatie 
    • begeleiding van en voorlichting aan patiënten

Referenties

  1. NIVEL. Incidenties en prevalenties (2014). Ga naar bron: NIVEL. Incidenties en prevalenties (2014).
  2. Spijker-Huiges A, Groenhof F, Winters JC, Van Wijhe M, Groenier KH, Van der Meer K. Radiating low back pain in general practice: Incidence, prevalence, diagnosis, and long-term clinical course of illness. Scand J Prim Health Care 2015;33:27-32.
  3. Hoy D, March L, Brooks P, Blyth F, Woolf A, Bain C, et al. The global burden of low back pain: Estimates from the global burden of disease 2010 study. Ann Rheum Dis 2014;73:968-74.
  4. Van Oostrom SH, Monique Verschuren WM, De Vet HC, Picavet HS. Ten year course of low back pain in an adult population-based cohort-the Doetinchem cohort study. Eur J Pain 2011;15:993-8.
  5. Ursum J, Spronk I, Davids R, Korevaar JC. Zorggebruik van patiënten met rugpijn in de huisartsenpraktijk (2014). Ga naar bron: Ursum J, Spronk I, Davids R, Korevaar JC. Zorggebruik van patiënten met rugpijn in de huisartsenpraktijk (2014).
  6. Theus R, Zaat JO, Uijen A, Enzing JJ. Rugpijn: Patienten versus onderzoek. Ned Tijdschr Geneeskd 2014;158:A7456.
  7. Lambeek LC, Van Tulder MW, Swinkels IC, Koppes LL, Anema JR, van MW. The trend in total cost of back pain in the netherlands in the period 2002 to 2007. Spine (Phila Pa 1976.) 2011;36:1050-8.
  8. Van Tulder MW, Koes BW. Ketenzorgrichtlijn aspecifieke lage rugklachten. Epidemiologie, preventie, diagnostiek, behandeling en richtlijnen. Houten: Bohn Stafleu van Loghum, 2013b.
  9. Ketenzorgrichtlijn aspecifieke lage rugklachten (2010). Ga naar bron: Ketenzorgrichtlijn aspecifieke lage rugklachten (2010).
  10. Taylor JB, Goode AP, George SZ, Cook CE. Incidence and risk factors for first-time incident low back pain: A systematic review and meta-analysis. Spine J 2014;14:2299-319.
  11. Shiri R, Karppinen J, Leino-Arjas P, Solovieva S, Viikari-Juntura E. The association between smoking and low back pain: A meta-analysis. Am J Med 2010b;123:87.e7-35.
  12. Shiri R, Karppinen J, Leino-Arjas P, Solovieva S, Viikari-Juntura E. The association between obesity and low back pain: A meta-analysis. Am J Epidemiol 2010a;171:135-54.
  13. Heuch I, Heuch I, Hagen K, Zwart JA. Body mass index as a risk factor for developing chronic low back pain: A follow-up in the nord-trondelag health study. Spine (Phila Pa 1976.) 2013;38:133-9.
  14. Heneweer H, Staes F, Aufdemkampe G, Van Rijn M, Vanhees L. Physical activity and low back pain: A systematic review of recent literature. Eur Spine J 2011;20:826-45.
  15. Lang J, Ochsmann E, Kraus T, Lang JW. Psychosocial work stressors as antecedents of musculoskeletal problems: A systematic review and meta-analysis of stability-adjusted longitudinal studies. Soc Sci Med 2012;75:1163-74.
  16. Van Tulder MW, Koes BW. Evidence-based handelen bij lage rugpijn. Epidemiologie, preventie, diagnostiek, behandeling en richtlijnen. Houten: Bohn Stafleu van Loghum, 2013a.
  17. Lotters F, Burdorf A, Kuiper J, Miedema H. Model for the work-relatedness of low-back pain. Scand J Work Environ Health 2003;29:431-40.
  18. Ramond A, Bouton C, Richard I, Roquelaure Y, Baufreton C, Legrand E, et al. Psychosocial risk factors for chronic low back pain in primary care--a systematic review. Fam Pract 2011;28:12-21.
  19. Chou R, Shekelle P. Will this patient develop persistent disabling low back pain? JAMA 2010;303:1295-302.
  20. Morso L, Kent P, Albert HB, Hill JC, Kongsted A, Manniche C. The predictive and external validity of the start back tool in danish primary care. Eur Spine J 2013;22:1859-67.
  21. Van Hooff M, Van Lankveld W, Anderson P, Apeldoorn A, Van Hartingsveld F, Ostelo R. The start back screening tool: Dutch version. Rugscreeningsinstrument (2011). Ga naar bron: Van Hooff M, Van Lankveld W, Anderson P, Apeldoorn A, Van Hartingsveld F, Ostelo R. The start back screening tool: Dutch version. Rugscreeningsinstrument (2011).
  22. Hill JC, Dunn KM, Lewis M, Mullis R, Main CJ, Foster NE, et al. A primary care back pain screening tool: Identifying patient subgroups for initial treatment. Arthritis Rheum 2008;59:632-41.
  23. Hill JC, Whitehurst DGT, Lewis M, Bryan S, Dunn KM, Foster NE, et al. Comparison of stratified primary care management for low back pain with current best practice (start back): A randomised controlled trial. Lancet 2011;378:1560-71.
  24. Mehling WE, Gopisetty V, Bartmess E, Acree M, Pressman A, Goldberg H, et al. The prognosis of acute low back pain in primary care in the united states: A 2-year prospective cohort study. Spine (Phila Pa 1976.) 2012;37:678-84.
  25. Itz CJ, Geurts JW, Van Kleef M, Nelemans P. Clinical course of non-specific low back pain: A systematic review of prospective cohort studies set in primary care. Eur J Pain 2013;17:5-15.
  26. Pengel LH, Herbert RD, Maher CG, Refshauge KM. Acute low back pain: Systematic review of its prognosis. BMJ 2003;327:323.
  27. Van der Horst-Bruinsma IE, Oostveen JCM, Van Denderen JC, De Sonnaville PBJ, Nurmohamed MT, Van Tubergen A, et al. Richtlijn voor de diagnostiek en behandeling van axiale spondyloartritis (2014). Ga naar bron: Van der Horst-Bruinsma IE, Oostveen JCM, Van Denderen JC, De Sonnaville PBJ, Nurmohamed MT, Van Tubergen A, et al. Richtlijn voor de diagnostiek en behandeling van axiale spondyloartritis (2014).
  28. Van Hoeven L, Luime J, Han H, Vergouwe Y, Weel A. Identifying axial spondyloarthritis in dutch primary care patients, ages 20-45 years, with chronic low back pain. Arthritis Care Res (Hoboken) 2014;66:446-53.
  29. Braun A, Saracbasi E, Grifka J, Schnitker J, Braun J. Identifying patients with axial spondyloarthritis in primary care: How useful are items indicative of inflammatory back pain? Ann Rheum Dis 2011;70:1782-7.
  30. Spoorenberg A, Van der Heijde D, De Klerk E, Dougados M, De Vlam K, Mielants H, et al. Relative value of erythrocyte sedimentation rate and C-reactive protein in assessment of disease activity in ankylosing spondylitis. J Rheumatol 1999;26:980-4.
  31. Alfieri A, Gazzeri R, Prell J, Rollinghoff M. The current management of lumbar spondylolisthesis. J Neurosurg Sci 2013;57:103-13.
  32. Kalpakcioglu B, Altinbilek T, Senel K. Determination of spondylolisthesis in low back pain by clinical evaluation. J Back Musculoskelet Rehabil 2009;22:27-32.
  33. Watters WC, 3rd, Bono CM, Gilbert TJ, Kreiner DS, Mazanec DJ, Shaffer WO, et al. An evidence-based clinical guideline for the diagnosis and treatment of degenerative lumbar spondylolisthesis. Spine J 2009;9:609-14.
  34. Snijders TJ, Notermans NC. Progressieve, opstijgende neurologische uitval: Een spinaal epiduraal abces dat zich presenteert als een syndroom van Guillain-Barre. Ned.Tijdschr.Geneeskd. 2008;152:1436-9.
  35. Opstelten W, Rimmelzwaan GF, van Essen GA, Bijlsma JW. Influenzavaccinatie van patienten met verminderde afweer: Veilig en effectief. Ned Tijdschr Geneeskd 2009;153:A902.
  36. May S, Littlewood C, Bishop A. Reliability of procedures used in the physical examination of non-specific low back pain: A systematic review. Aust J Physiother 2006;52:91-102.
  37. Rubinstein SM, Van Tulder M. A best-evidence review of diagnostic procedures for neck and low-back pain. Best Pract Res Clin Rheumatol 2008;22:471-82.
  38. CBO Kwaliteitsinstituut voor de Gezondheidszorg. Richtlijn aspecifieke lage rugklachten. Alphen a/d Rijn: Van Zuiden Communications, 2003.
  39. Chou D, Samartzis D, Bellabarba C, Patel A, Luk KD, Kisser JM, et al. Degenerative magnetic resonance imaging changes in patients with chronic low back pain: A systematic review. Spine (Phila Pa 1976) 2011;36:S43-53.
  40. Jarvik JG, Deyo RA. Diagnostic evaluation of low back pain with emphasis on imaging. Ann Intern Med 2002;137:586-97.
  41. Raastad J, Reiman M, Coeytaux R, Ledbetter L, Goode AP. The association between lumbar spine radiographic features and low back pain: A systematic review and meta-analysis. Semin Arthritis Rheum 2015;44:571-85.
  42. Steffens D, Hancock MJ, Pereira LS, Kent PM, Latimer J, Maher CG. Do MRI findings identify patients with low back pain or sciatica who respond better to particular interventions? A systematic review. Eur Spine J 2016;25:1170-87.
  43. Carragee E, Alamin T, Cheng I, Franklin T, Van den Haak E, Hurwitz E. Are first-time episodes of serious LBP associated with new MRI findings? Spine J 2006;6:624-35.
  44. Jensen MC, Brant-Zawadzki MN, Obuchowski N, Modic MT, Malkasian D, Ross JS. Magnetic resonance imaging of the lumbar spine in people without back pain. N Engl J Med 1994;331:69-73.
  45. Chou R, Fu R, Carrino JA, Deyo RA. Imaging strategies for low-back pain: Systematic review and meta-analysis. Lancet 2009;373:463-72.
  46. Ash LM, Modic MT, Obuchowski NA, Ross JS, Brant-Zawadzki MN, Grooff PN. Effects of diagnostic information, per se, on patient outcomes in acute radiculopathy and low back pain. AJNR Am J Neuroradiol 2008;29:1098-103.
  47. You JJ, Bederman SS, Symons S, Bell CM, Yun L, Laupacis A, et al. Patterns of care after magnetic resonance imaging of the spine in primary care. Spine (Phila Pa 1976) 2013;38:51-9.
  48. Deyo RA, Jarvik JG, Chou R. Low back pain in primary care. BMJ 2014;349:g4266.
  49. Joines JD, McNutt RA, Carey TS, Deyo RA, Rouhani R. Finding cancer in primary care outpatients with low back pain: A comparison of diagnostic strategies. J Gen Intern Med 2001;16:14-23.
  50. Henschke N, Maher CG, Refshauge KM, Herbert RD, Cumming RG, Bleasel J, et al. Prevalence of and screening for serious spinal pathology in patients presenting to primary care settings with acute low back pain. Arthritis Rheum 2009;60:3072-80.
  51. Dahm KT, Brurberg KG, Jamtvedt G, Hagen KB. Advice to rest in bed versus advice to stay active for acute low-back pain and sciatica. Cochrane Database Syst Rev 2010:CD007612.
  52. Hayden JA, Van Tulder MW, Malmivaara A, Koes BW. Exercise therapy for treatment of non-specific low back pain. Cochrane Database Syst Rev 2005:CD000335.
  53. Van der Giessen RN, Speksnijder CM, Helders PJ. The effectiveness of graded activity in patients with non-specific low-back pain: A systematic review. Disabil Rehabil 2012;34:1070-6.
  54. Nordeman L, Nilsson B, Moller M, Gunnarsson R. Early access to physical therapy treatment for subacute low back pain in primary health care: A prospective randomized clinical trial. Clin J Pain 2006;22:505-11.
  55. Pengel LH, Refshauge KM, Maher CG, Nicholas MK, Herbert RD, McNair P. Physiotherapist-directed exercise, advice, or both for subacute low back pain: A randomized trial. Ann Intern Med 2007;146:787-96.
  56. Van Middelkoop M, Rubinstein SM, Kuijpers T, Verhagen AP, Ostelo R, Koes BW, et al. A systematic review on the effectiveness of physical and rehabilitation interventions for chronic non-specific low back pain. Eur Spine J 2011;20:19-39.
  57. Macedo LG, Smeets RJ, Maher CG, Latimer J, McAuley JH. Graded activity and graded exposure for persistent nonspecific low back pain: A systematic review. Phys Ther 2010;90:860-79.
  58. Smith BE, Littlewood C, May S. An update of stabilisation exercises for low back pain: A systematic review with meta-analysis. BMC Musculoskelet Disord 2014;15:416.
  59. Oesch P, Kool J, Hagen KB, Bachmann S. Effectiveness of exercise on work disability in patients with non-acute non-specific low back pain: Systematic review and meta-analysis of randomised controlled trials. J Rehabil Med 2010;42:193-205.
  60. Lopez-de-Uralde-Villanueva I, Munoz-Garcia D, Gil-Martinez A, Pardo-Montero J, Munoz-Plata R, Angulo-Diaz-Parreno S, et al. A systematic review and meta-analysis on the effectiveness of graded activity and graded exposure for chronic nonspecific low back pain. Pain Med 2016:17:172-88.
  61. Cramer H, Lauche R, Haller H, Dobos G. A systematic review and meta-analysis of yoga for low back pain. Clin J Pain 2013;29:450-60.
  62. Yamato TP, Maher CG, Saragiotto BT, Hancock MJ, Ostelo RW, Cabral CM, et al. Pilates for low back pain: Complete republication of a cochrane review. Spine (Phila Pa 1976) 2015;41:1013-21.
  63. Rubinstein SM, Terwee CB, Assendelft WJ, De Boer MR, Van Tulder MW. Spinal manipulative therapy for acute low-back pain. Cochrane Database Syst Rev 2012;9:CD008880.
  64. Cruser A, Maurer D, Hensel K, Brown SK, White K, Stoll ST. A randomized, controlled trial of osteopathic manipulative treatment for acute low back pain in active duty military personnel. J Man Manip Ther 2012;20:5-15.
  65. Ernst E. Adverse effects of spinal manipulation: A systematic review. J R Soc Med 2007;100:330-8.
  66. Rubinstein SM, Van Middelkoop M, Assendelft WJ, De Boer MR, Van Tulder MW. Spinal manipulative therapy for chronic low-back pain. Cochrane Database Syst Rev 2011:CD008112.
  67. Balthazard P, De Goumoens P, Rivier G, Demeulenaere P, Ballabeni P, Deriaz O. Manual therapy followed by specific active exercises versus a placebo followed by specific active exercises on the improvement of functional disability in patients with chronic non specific low back pain: A randomized controlled trial. BMC Musculoskelet Disord 2012;13:162.
  68. Cecchi F, Molino-Lova R, Chiti M, Pasquini G, Paperini A, Conti AA, et al. Spinal manipulation compared with back school and with individually delivered physiotherapy for the treatment of chronic low back pain: A randomized trial with one-year follow-up. Clin Rehabil 2010;24:26-36.
  69. Haas M, Vavrek D, Peterson D, Polissar N, Neradilek MB. Dose-response and efficacy of spinal manipulation for care of chronic low back pain: A randomized controlled trial. Spine J 2014;14:1106-16.
  70. Senna MK, Machaly SA. Does maintained spinal manipulation therapy for chronic nonspecific low back pain result in better long-term outcome? Spine (Phila Pa 1976) 2011;36:1427-37.
  71. Henschke N, Ostelo RW, Van Tulder MW, Vlaeyen JW, Morley S, Assendelft WJ, et al. Behavioural treatment for chronic low-back pain. Cochrane Database Syst Rev 2010:CD002014.
  72. Richmond H, Hall AM, Copsey B, Hansen Z, Williamson E, Hoxey-Thomas N, et al. The effectiveness of cognitive behavioural treatment for non-specific low back pain: A systematic review and meta-analysis. PLoS One 2015;10:e0134192.
  73. Lamb SE, Hansen Z, Lall R, Castelnuovo E, Withers EJ, Nichols V, et al. Group cognitive behavioural treatment for low-back pain in primary care: A randomised controlled trial and cost-effectiveness analysis. Lancet 2010;375:916-23.
  74. Lamb SE, Mistry D, Lall R, Hansen Z, Evans D, Withers EJ, et al. Group cognitive behavioural interventions for low back pain in primary care: Extended follow-up of the back skills training trial (isrctn54717854). Pain 2012;153:494-501.
  75. Siemonsma PC, Stuive I, Roorda LD, Vollebregt JA, Walker MF, Lankhorst GJ, et al. Cognitive treatment of illness perceptions in patients with chronic low back pain: A randomized controlled trial. Phys Ther 2013;93:435-48.
  76. Monticone M, Ferrante S, Rocca B, Baiardi P, Farra FD, Foti C. Effect of a long-lasting multidisciplinary program on disability and fear-avoidance behaviors in patients with chronic low back pain: Results of a randomized controlled trial. Clin J Pain 2013;29:929-38.
  77. Khan M, Akhter S, Soomro RR, Ali SS. The effectiveness of cognitive behavioral therapy (CBT) with general exercises versus general exercises alone in the management of chronic low back pain. Pak J Pharm Sci 2014;27:1113-6.
  78. Vibe Fersum K, O’Sullivan P, Skouen JS, Smith A, Kvale A. Efficacy of classification-based cognitive functional therapy in patients with non-specific chronic low back pain: A randomized controlled trial. Eur J Pain 2013;17:916-28.
  79. Lambeek LC, Bosmans JE, Van Royen BJ, Van Tulder MW, Van Mechelen W, Anema JR. Effect of integrated care for sick listed patients with chronic low back pain: Economic evaluation alongside a randomised controlled trial. BMJ 2010;341:c6414.
  80. Kamper SJ, Apeldoorn AT, Chiarotto A, Smeets RJ, Ostelo RW, Guzman J, et al. Multidisciplinary biopsychosocial rehabilitation for chronic low back pain. Cochrane Database Syst Rev 2014;9:CD000963.
  81. Davies RA, Maher CG, Hancock MJ. A systematic review of paracetamol for non-specific low back pain. Eur Spine J 2008;17:1423-30.
  82. Williams CM, Maher CG, Latimer J, McLachlan AJ, Hancock MJ, Day RO, et al. Efficacy of paracetamol for acute low-back pain: A double-blind, randomised controlled trial. Lancet 2014;384:1586-96.
  83. Roelofs PD, Deyo RA, Koes BW, Scholten RJ, Van Tulder MW. Non-steroidal anti-inflammatory drugs for low back pain. Cochrane Database Syst Rev 2008:CD000396.
  84. Ashworth J, Green DJ, Dunn KM, Jordan KP. Opioid use among low back pain patients in primary care: Is opioid prescription associated with disability at 6-month follow-up? Pain 2013;154:1038-44.
  85. Franklin GM, Stover BD, Turner JA, Fulton-Kehoe D, Wickizer TM. Early opioid prescription and subsequent disability among workers with back injuries: The disability risk identification study cohort. Spine (Phila Pa 1976) 2008;33:199-204.
  86. Webster BS, Verma SK, Gatchel RJ. Relationship between early opioid prescribing for acute occupational low back pain and disability duration, medical costs, subsequent surgery and late opioid use. Spine (Phila Pa 1976) 2007;32:2127-32.
  87. Chaparro LE, Furlan AD, Deshpande A, Mailis-Gagnon A, Atlas S, Turk DC. Opioids compared to placebo or other treatments for chronic low-back pain. Cochrane Database Syst Rev 2013;8:CD004959.
  88. Kuijpers T, Van Middelkoop M, Rubinstein SM, Ostelo R, Verhagen A, Koes BW, et al. A systematic review on the effectiveness of pharmacological interventions for chronic non-specific low-back pain. Eur Spine J 2011;20:40-50.
  89. Cawston H, Davie A, Paget MA, Skljarevski V, Happich M. Efficacy of duloxetine versus alternative oral therapies: An indirect comparison of randomised clinical trials in chronic low back pain. Eur Spine J 2013;22:1996-2009.
  90. Chou R, Huffman LH. Medications for acute and chronic low back pain: A review of the evidence for an american pain society/american college of physicians clinical practice guideline. Ann Intern Med 2007;147:505-14.
  91. Chung JW, Zeng Y, Wong TK. Drug therapy for the treatment of chronic nonspecific low back pain: Systematic review and meta-analysis. Pain Physician 2013;16:E685-704.
  92. Muehlbacher M, Nickel MK, Kettler C, Tritt K, Lahmann C, Leiberich PK, et al. Topiramate in treatment of patients with chronic low back pain: A randomized, double-blind, placebo-controlled study. Clin J Pain 2006;22:526-31.
  93. KNMP. Informatorium medicamentorum 2015. Den Haag: Koninklijke Nederlandse Maatschappij der bevordering der Pharmacie, 2015.
  94. Di Iorio D, Henley E, Doughty A. A survey of primary care physician practice patterns and adherence to acute low back problem guidelines. Arch Fam Med 2000;9:1015-21.
  95. Van de Lisdonk EH, Huisman IA. Lage-rugpijn en benzodiazepine: Een relatie vol spanning. Huisarts Wet 1998;41:75-9.
  96. Van Tulder MW, Touray T, Furlan AD, Solway S, Bouter LM. Muscle relaxants for non-specific low back pain. Cochrane Database Syst Rev 2003:CD004252.
  97. Chou R, Hashimoto R, Friedly J, Fu R, Dana T, Sullivan S, et al. Pain management injection therapies for low back pain (2015). AHRQ Technology assessment report. Ga naar bron: Chou R, Hashimoto R, Friedly J, Fu R, Dana T, Sullivan S, et al. Pain management injection therapies for low back pain (2015). AHRQ Technology assessment report.
  98. Staal JB, De Bie R, De Vet HC, Hildebrandt J, Nelemans P. Injection therapy for subacute and chronic low-back pain. Cochrane Database Syst Rev 2008:CD001824.
  99. Maas ET, Ostelo RW, Niemisto L, Jousimaa J, Hurri H, Malmivaara A, et al. Radiofrequency denervation for chronic low back pain. Cochrane Database Syst Rev 2015;10:CD008572.
  100. Punt IM, Cleutjens JP, De Bruin T, Willems PC, Kurtz SM, Van Rhijn LW, et al. Periprosthetic tissue reactions observed at revision of total intervertebral disc arthroplasty. Biomaterials 2009;30:2079-84.
  101. Putzier M, Funk JF, Schneider SV, Gross C, Tohtz SW, Khodadadyan-Klostermann C, et al. Charite total disc replacement--clinical and radiographical results after an average follow-up of 17 years. Eur Spine J 2006;15:183-95.
  102. Van Ooij A, Oner FC, Verbout AJ. Complications of artificial disc replacement: A report of 27 patients with the SB Charité disc. J Spinal Disord Tech 2003;16:369-83.
  103. Jacobs W, Van der Gaag NA, Tuschel A, De Kleuver M, Peul W, Verbout AJ, et al. Total disc replacement for chronic back pain in the presence of disc degeneration. Cochrane Database Syst Rev 2012;9:CD008326.
  104. Hellum C, Johnsen LG, Storheim K, Nygaard OP, Brox JI, Rossvoll I, et al. Surgery with disc prosthesis versus rehabilitation in patients with low back pain and degenerative disc: Two year follow-up of randomised study. BMJ 2011;342:d2786.
  105. Phillips FM, Slosar PJ, Youssef JA, Andersson G, Papatheofanis F. Lumbar spine fusion for chronic low back pain due to degenerative disc disease: A systematic review. Spine (Phila Pa 1976) 2013;38:E409-22.
  106. Wang X, Wanyan P, Tian JH, Hu L. Meta-analysis of randomized trials comparing fusion surgery to non-surgical treatment for discogenic chronic low back pain. J Back Musculoskelet Rehabil 2015;28:621-7.
  107. Deyo RA, Rainville J, Kent DL. What can the history and physical examination tell us about low back pain? JAMA 1992;268:760-5.
  108. Downie A, Williams CM, Henschke N, Hancock MJ, Ostelo RW, De Vet HC, et al. Red flags to screen for malignancy and fracture in patients with low back pain: Systematic review. BMJ 2013;347:f7095.
  109. Costa Lda C, Maher CG, McAuley JH, Hancock MJ, Herbert RD, Refshauge KM, et al. Prognosis for patients with chronic low back pain: Inception cohort study. BMJ 2009;339:b3829.